DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and MPO

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_000241.1 Gene:MPO HGNCID:7218 Length:745 Species:Homo sapiens

Alignment Length:105 Identity:17/106 (16%)
Similarity:40/106 (38%) Gaps:20/106 (19%)


  Fly   234 LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASL------WLPVQLILLLKSLDVIETNTLTKL 292
            :|..|....:.::.:.|    ..|..::...|..|      |...:.:..::....:...:|.::
Human   642 IWMGGVSEPLKRKGRVG----PLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRI 702

  Fly   293 VIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSS 332
            :...|..|....::       .|:|.::.:.|   ||||:
Human   703 ICDNTGITTVSKNN-------IFMSNSYPRDF---VNCST 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433
7tm_1 55..313 CDD:278431 10/85 (12%)
MPONP_000241.1 myeloperoxidase_like 316..728 CDD:188656 13/100 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1294084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.