| Sequence 1: | NP_001263042.1 | Gene: | AstA-R2 / 43393 | FlyBaseID: | FBgn0039595 | Length: | 357 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_663415.1 | Gene: | Uts2r / 217369 | MGIID: | 2183450 | Length: | 385 | Species: | Mus musculus |
| Alignment Length: | 348 | Identity: | 97/348 - (27%) |
|---|---|---|---|
| Similarity: | 166/348 - (47%) | Gaps: | 53/348 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MENTT--MLA-------------NISLNATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAI 50
Fly 51 TGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQ 115
Fly 116 YLIVVTAFASIYTLVLMSIDRFLAVVHPI----RSRMMRTENITLIAIVTLWIVVLVVSVPVAFT 176
Fly 177 HDVVVDYDAKKNITYGMCTFTTNDFLGP---RTYQVTFFISSYLLPLMIISGLYMRMIMRLW--R 236
Fly 237 QGTGVRMSKESQR-GRKRVTRLVVVVVIAFASLWLPVQLILLLKSL-DVIETNTLTKLVIQVTAQ 299
Fly 300 TLAYSSSCINPLLYAFLSENFRK 322 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AstA-R2 | NP_001263042.1 | 7tm_4 | 47..>164 | CDD:304433 | 39/120 (33%) |
| 7tm_1 | 55..313 | CDD:278431 | 78/268 (29%) | ||
| Uts2r | NP_663415.1 | 7tm_1 | 72..316 | CDD:278431 | 76/263 (29%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24230 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||