DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and Ltb4r1

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006518729.1 Gene:Ltb4r1 MGIID:1309472 Length:411 Species:Mus musculus

Alignment Length:298 Identity:78/299 (26%)
Similarity:136/299 (45%) Gaps:53/299 (18%)


  Fly    37 LPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMV 101
            ||.::   ..|....|..||..|:..::.....|:.|.|:::|||.|||. |:|..||.......
Mouse    82 LPIVL---LSVALAVGLPGNSFVVWSILKRMQKRTVTALLVLNLALADLA-VLLTAPFFLHFLAR 142

  Fly   102 YYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVV 166
            ..|.:....||...|:..::.:||:..:.:||:||.|||..|..|:.:||:......:..:|:|.
Mouse   143 GTWSFREMGCRLCHYVCGISMYASVLLITIMSLDRSLAVARPFMSQKVRTKAFARWVLAGIWVVS 207

  Fly   167 LVVSVPVAFTHDV---------VVDYDAKKNITYGMCTFTTNDFLGPRTYQVTF-FISSYLLPLM 221
            .::::||.....|         ..:|..|::                :.:.:.| .|:.:|||.:
Mouse   208 FLLAIPVLVYRTVKWNNRTLICAPNYPNKEH----------------KVFHLLFEAITGFLLPFL 256

  Fly   222 IISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVI-- 284
            .:...|         ...|.|:.....|..:|..||||::::|||:.|||..|:.|:::...:  
Mouse   257 AVVASY---------SDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHLVNLVEAGRTVAG 312

  Fly   285 -ETNT-------LTKLVIQVTAQTLAYSSSCINPLLYA 314
             :.|:       |.:.|:    ..||:.||.:||:|||
Mouse   313 WDKNSPAGQRLRLARYVL----IALAFLSSSVNPVLYA 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 36/117 (31%)
7tm_1 55..313 CDD:278431 72/278 (26%)
Ltb4r1XP_006518729.1 7tm_1 97..345 CDD:278431 72/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56152039
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.