DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and Kiss1r

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_444474.1 Gene:Kiss1r MGIID:2148793 Length:396 Species:Mus musculus

Alignment Length:328 Identity:105/329 (32%)
Similarity:167/329 (51%) Gaps:33/329 (10%)


  Fly    35 GTLP-----WIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPF 94
            |:.|     |:|..||..:.:.|..||.|||.|:..:.:|::.||..|.||||.|:.|::.|:||
Mouse    34 GSAPRPLDAWLVPLFFATLMLLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPF 98

  Fly    95 TATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAI 159
            ||..|.:..|..|.|.|:.|.|:..|:..|:..||..||:||:...|.|:|:...||..:.|...
Mouse    99 TALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVS 163

  Fly   160 VTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLG---PRTYQVTFFISSYLLPLM 221
            :::|:....||.||...|          .::.|..|:.:..|..   .|.:.:...::.|||||:
Mouse   164 LSIWVGSAAVSAPVLALH----------RLSPGPRTYCSEAFPSRALERAFALYNLLALYLLPLL 218

  Fly   222 IISGLYMRMIMRLWRQGT----------GVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLIL 276
            .....|..|:..|.|...          |..:::.:...|.:|:|||..||:.||:.|.|:||.|
Mouse   219 ATCACYGAMLRHLGRAAVRPAPTDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFL 283

  Fly   277 LLKSL---DVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQN-- 336
            :|::|   ......:.....:::.|..::||:|.:||||||||..:||:||.:...|..:.|.  
Mouse   284 VLQALGPSGAWHPRSYAAYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRP 348

  Fly   337 YTS 339
            :||
Mouse   349 HTS 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 44/117 (38%)
7tm_1 55..313 CDD:278431 86/274 (31%)
Kiss1rNP_444474.1 7tm_4 51..>168 CDD:304433 44/117 (38%)
7tm_1 59..323 CDD:278431 86/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.