DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and ltb4r2a

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_017212293.2 Gene:ltb4r2a ZFINID:ZDB-GENE-140106-272 Length:402 Species:Danio rerio

Alignment Length:330 Identity:94/331 (28%)
Similarity:154/331 (47%) Gaps:60/331 (18%)


  Fly    17 NEENITS---FFTDEEWLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIV 78
            |..|.||   ...|.:..||.|..      ...::.:.|..||:.::..::.....||.|.|:|:
Zfish    37 NLSNNTSGRGSIVDNKGGAITGAA------ILSLVFLLGVPGNVFIMWSILARARRRSITTLLIL 95

  Fly    79 NLAAADLMFVILCIPFTATDYMVYY----WPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLA 139
            |||.|| .|::|..||    :|||.    |.:....|:.:.||.....:|||:.::|||:.|.:|
Zfish    96 NLAFAD-GFLMLLTPF----FMVYLVQRSWVFSLALCKVLYYLCCANMYASIFMIMLMSLHRLVA 155

  Fly   140 VVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGP 204
            :|.|.|........:....:|.||::.|.:|.||....:::  .|:||...: :|     |.:.|
Zfish   156 IVWPKRVGAKTERKMLTRVLVGLWVLALGLSAPVLAFRNIL--SDSKKPEKF-VC-----DCIHP 212

  Fly   205 RT-YQVTFF----ISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIA 264
            .| |:|..:    :..:|||..:|.|.| ..|:|        |:.|...|.|.|..:|::|:|:.
Zfish   213 ETQYEVMQYSMETLLGFLLPYGVIIGSY-TCILR--------RIRKTRFRRRIRSEKLILVIVVT 268

  Fly   265 FASLWLPVQLILLLK--------------SLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAF 315
            |...|||..:|.:::              .|..|..|      ::....|:|:.||||||:||.|
Zfish   269 FGLFWLPYHIINMVQVTAALLPEGSAAKHRLQEIRAN------MRALTSTVAFVSSCINPVLYTF 327

  Fly   316 LSENF 320
            ..:::
Zfish   328 AGKSY 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 38/121 (31%)
7tm_1 55..313 CDD:278431 83/281 (30%)
ltb4r2aXP_017212293.2 7tm_GPCRs 56..337 CDD:333717 88/312 (28%)
TM helix 1 58..82 CDD:320095 4/30 (13%)
TM helix 2 91..112 CDD:320095 11/26 (42%)
TM helix 3 128..150 CDD:320095 8/22 (36%)
TM helix 4 173..189 CDD:320095 6/16 (38%)
TM helix 5 218..241 CDD:320095 7/24 (29%)
TM helix 6 256..281 CDD:320095 9/25 (36%)
TM helix 7 304..329 CDD:320095 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.