DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and si:dkey-85k7.11

DIOPT Version :8

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_684184.3 Gene:si:dkey-85k7.11 / 556323 ZFINID:ZDB-GENE-160728-145 Length:313 Species:Danio rerio

Alignment Length:167 Identity:40/168 (24%)
Similarity:60/168 (36%) Gaps:45/168 (27%)


  Fly   175 GTFRRLFGNNQNYIPNNRDVI-INRG------HLAASADFFFGDQLCATFKYVNAVPQFKSINDG 232
            |...:|...:|..:.:..|.: ..||      |.|.:.|      ..||:...|.|||.....:|
Zfish   131 GEIDQLLEESQAVLADYVDAVEFARGPLNPDQHQAGNQD------KAATYTLTNVVPQITEFLEG 189

  Fly   233 NWETIERFVRNSVTGNNFVNVRTGARGVLSLPSGNRPKNVFLSG--------NRNPVPQWMY--- 286
            .|.|....||..:  |||      .||...:.:|     |.:||        :|..||::::   
Zfish   190 PWATYIDMVRRRL--NNF------CRGTAYVVTG-----VTVSGMTIRRGKEDRMAVPKYLWSAY 241

  Fly   287 ---KIVRNANNQ-----PIVAFLTLNNIYARQRPAAP 315
               :..||:..:     |..|...||.|........|
Zfish   242 CCPRFDRNSPYEVRFMFPTYAAYALNEIVGHSVTEVP 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 40/168 (24%)
si:dkey-85k7.11XP_684184.3 Endonuclease_NS 77..289 CDD:214889 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.