powered by:
Protein Alignment CG14062 and si:dkey-85k7.11
DIOPT Version :9
| Sequence 1: | NP_001034074.1 |
Gene: | CG14062 / 43389 |
FlyBaseID: | FBgn0039592 |
Length: | 346 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_684184.3 |
Gene: | si:dkey-85k7.11 / 556323 |
ZFINID: | ZDB-GENE-160728-145 |
Length: | 313 |
Species: | Danio rerio |
| Alignment Length: | 167 |
Identity: | 40/167 - (23%) |
| Similarity: | 60/167 - (35%) |
Gaps: | 45/167 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 175 GTFRRLFGNNQNYIPNNRDVI-INRG------HLAASADFFFGDQLCATFKYVNAVPQFKSINDG 232
|...:|...:|..:.:..|.: ..|| |.|.:.| ..||:...|.|||.....:|
Zfish 131 GEIDQLLEESQAVLADYVDAVEFARGPLNPDQHQAGNQD------KAATYTLTNVVPQITEFLEG 189
Fly 233 NWETIERFVRNSVTGNNFVNVRTGARGVLSLPSGNRPKNVFLSG--------NRNPVPQWMY--- 286
.|.|....||..: ||| .||...:.:| |.:|| :|..||::::
Zfish 190 PWATYIDMVRRRL--NNF------CRGTAYVVTG-----VTVSGMTIRRGKEDRMAVPKYLWSAY 241
Fly 287 ---KIVRNANNQ-----PIVAFLTLNNIYARQRPAAP 315
:..||:..: |..|...||.|........|
Zfish 242 CCPRFDRNSPYEVRFMFPTYAAYALNEIVGHSVTEVP 278
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
40 |
1.000 |
Domainoid score |
I12511 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D556753at33208 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.