DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and Sid

DIOPT Version :8

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster

Alignment Length:370 Identity:109/371 (29%)
Similarity:164/371 (44%) Gaps:44/371 (12%)


  Fly     1 MLRILLLLLAFCALAHGQCRFTRAQVQGTNRIFMVRGQNRQLSLKRTASSAVGETLQMWCNPRDI 65
            ||.||.|.. |.......|....|.: ..|.:::.: .|....::|:....:.:||.:.|| ..:
  Fly     7 MLTILSLYF-FVGSVQANCLIDLAHL-NANYVYLSQ-NNGVYDIQRSDIVEIHQTLYLLCN-GGL 67

  Fly    66 VATT--CQAGRVPAFQPPLPMTCRAAPAAITTPVQDRRC--PATMYRVGYNVGNNQFLELYRACF 126
            ..||  |:...|  |.|.|.....|.|..:...|.|..|  |:..:.||::. |.:|:||||.||
  Fly    68 HRTTFLCRYDSV--FSPALSSAACAPPDPVVVKVPDTSCSIPSATFAVGFSF-NGRFMELYRNCF 129

  Fly   127 DTRAVRAIFVEHRVYGKPFYIT---RPCVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQNYI 188
            |.   .::..:|.:|....|:.   ||...:.||.:..|.|.| |..|..........|..|   
  Fly   130 DG---YSLAFQHSIYKAYRYVNTVPRPNPTWQSDQLSGGFDNA-YEGRATQACLLTNLGAVQ--- 187

  Fly   189 PNNRDVIINRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTG------ 247
            |..:   .:|||:..::.|...:...:||:|:||:||::.:|.|.|:.:|.:|.|.|.|      
  Fly   188 PQCK---FDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPI 249

  Fly   248 -NNFVNVRT--------GARGVLSL---PSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPIVAF 300
             ||....||        ||.||..|   .:.|......|..|:.|||:||||||.:.:....| .
  Fly   250 INNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIVSHLSGDKWV-M 313

  Fly   301 LTLNNIYARQRPAAPNFCQPVNC-PVALVNTAQAGFSFCCNPATF 344
            ||.|::....:.|....|..:.| |...:||...|.:.||:|..|
  Fly   314 LTYNDVSLPNQQALNQICHVIPCHPGLNLNTKDVGHTVCCDPYRF 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 82/266 (31%)
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131073204
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556753at33208
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.