DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and pnu1

DIOPT Version :8

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_594598.2 Gene:pnu1 / 2542291 PomBaseID:SPAC17C9.08 Length:322 Species:Schizosaccharomyces pombe

Alignment Length:275 Identity:67/276 (24%)
Similarity:90/276 (33%) Gaps:82/276 (30%)


  Fly    93 ITTPVQDRRCPATMYRVGYNVGNNQFLELYRACFDTRAVRAIFVEHRVYGKPFYITRPCVQFSSD 157
            |..||.|:|         .|.|       |.:.||.|.           ..|||......|.|.:
pombe    68 IPGPVADQR---------VNHG-------YMSVFDRRT-----------RNPFYTAETITQESLN 105

  Fly   158 GVISGADEASYTV-RNIHGTFRRLFGNNQNYIPNNRDVIINRGHLAASADFFFGDQ-LCATFKYV 220
            ........:.:.. .||...|:...|   :|..:..|    |||...:||..|..: :..||...
pombe   106 QRKGNRRYSEFVPDDNIPEMFQAKLG---DYRGSGYD----RGHQVPAADCKFSQEAMNETFYLS 163

  Fly   221 NAVPQFKSINDG----NWETIERFVRNSVTGNNFVNVRTGARGVLSLPSGN-------------R 268
            |..||   :.||    .|...|.:.|...:....|.:.||.   |.||..|             .
pombe   164 NMCPQ---VGDGFNRNYWAYFEDWCRRLTSKYGSVTIMTGP---LYLPKKNERGQWEVQYRVIGN 222

  Fly   269 PKNVFLSGNRNPVPQWMYKIV-----RNANNQPIVAFLTLNNIYARQRPAAPNFCQPVN---CPV 325
            |.||       .||...:|::     ....:.|.||...|.|     :|.|.||  |:.   .||
pombe   223 PPNV-------AVPTHFFKVIIAEKSGEPTSSPSVAAFVLPN-----KPIADNF--PLKNFAVPV 273

  Fly   326 ALVNTAQAGFSFCCN 340
            .:|..| :|.....|
pombe   274 EVVERA-SGLEILSN 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 62/267 (23%)
pnu1NP_594598.2 NUC1 5..309 CDD:224777 67/276 (24%)
NUC 78..289 CDD:214683 62/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.