DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and CG15695

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_650920.3 Gene:CG15695 FlyBaseID:FBgn0038832 Length:725 Species:Drosophila melanogaster

Alignment Length:671 Identity:238/672 (35%)
Similarity:362/672 (54%) Gaps:71/672 (11%)


  Fly    25 IKTQNANTKPRVSEVTGSDDTNSDIPPAEEDRNVQDVVR-----PA------------------Y 66
            :.|:..:|:...:::..::.|..|........:..:||.     ||                  |
  Fly    92 LSTEKQSTEAIYNKLADTESTTEDQTEITTVDHTDEVVESSTSSPATGASKTETLYALEGNGKKY 156

  Fly    67 FVESAKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFINESLASIILNSN 131
            ||.|.:|::.:.:|||::...|:....:..|.....::|..|:::...|.|..||       || 
  Fly   157 FVHSPQCQMSHPNPFANNIQHIYKKHSYIVCDKSRDMITVNYNVTDSTYRLHKNE-------NS- 213

  Fly   132 GGEYNCYYQEITR-------DRKHDSYDKMERKYFSQNYEVPLHVEGLILTCHRLGNESDILQSD 189
                .|.:::|.|       |.|:.....:|   |.|::.||..|..:|..|.|...:. :.|.|
  Fly   214 ----TCCFKQILRAGTSANADHKYKLGPCVE---FHQDFLVPTEVSAMITYCRRPPFDK-VSQKD 270

  Fly   190 AYNLIQYRPPPKGLSLKPSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGD 254
            |::.:..|.........|.:|:||||::||||:||:||..|||::|::|....|||.|||||:||
  Fly   271 AFSFVHPRKDQIENPTTPHRRRPSVLLWGIDSISRMNLELTMPRMYEYLNNQHWFELQGYNKMGD 335

  Fly   255 NTFPNLLAILTGYNPESAIKKVCNWHEDGCLDRTPFIWHYFRNASYLTAYAEDEAGINTFNYWKP 319
            ||||||:|:|||:|...|..: |:..:...||..||||..|::..|.||:|||.:..:||:|...
  Fly   336 NTFPNLMAVLTGFNKTYANAR-CHPEKVRGLDACPFIWKDFKDKGYTTAFAEDWSKFSTFDYSSR 399

  Fly   320 GFLEQPTDFYLRPLQKAIESGLNTWKCSDCSMKYCIGRRITSSYAYDMARNF--ANRFVDERPIW 382
            ||...|||.|.|||..|:|..|...:..  .|.||:||:..|.|.|||...|  .||   ....:
  Fly   400 GFFNPPTDVYGRPLVLAVEKELTILQRG--QMPYCLGRKPASEYIYDMGVQFTMVNR---NSTFF 459

  Fly   383 GLFWSNSFSHDSFQMPSKMEDYVLQYLLDFEADGVFDQSIMVFLSDHGSRYGRLMSLPSGFLEER 447
            |:||:|:|||:.|.|||.|::.:::|:...:.:|:.|.:|::|.||||||:|.|.:|.|||:|||
  Fly   460 GMFWTNTFSHNDFSMPSAMDERMVKYMRTLDKNGIMDNTIIIFFSDHGSRFGPLRNLDSGFVEER 524

  Fly   448 LPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYDLHNTLKHIIELGGTPDGQTLPKAADCPKCQ 512
            ||.::|.:|.|.|.:||:..|.|::|:|||||.||:|.||:||:|| .||..: ||:...|..|.
  Fly   525 LPFIYIRVPRWIREKYPKLLRNLQMNKNRLTSPYDIHATLRHILEL-DTPKDK-LPRPDGCSSCH 587

  Fly   513 SLFYPVDETRSCEDAGIPEHFCTCVPYKRLDT--QWAKSIAPKVIGRINEYLAGRNLSKICSELT 575
            |:|..||.:|:|..|||.:|:|.|..:..:.|  ..|:|::.:::..||||:|.:..:|.||.|.
  Fly   588 SVFEEVDWSRNCSQAGIEDHWCACNSFSDVPTTDPSARSMSTQLVEAINEYVASKKGTKRCSRLK 652

  Fly   576 LSYIHLTEMKVELDQNFHDDVPRAELGTYRTMFKVKQNSADFRATVIFNNVTDSVEVEVPTISRL 640
            |:.|...:.             |.....|......:...|.|.|||.::.....:..::|:||||
  Fly   653 LNRISSVQR-------------RGNSNRYLIQLMAQPGDALFEATVDWDASAQRIPAQMPSISRL 704

  Fly   641 DSYENVSTCVKDKTDKMYCIC 661
            |:|...|.|...|..|.||||
  Fly   705 DTYAAKSRCSSVKETKKYCIC 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 199/501 (40%)
ALP_like 212..493 CDD:293745 137/283 (48%)
CG15695NP_650920.3 DUF229 180..656 CDD:281053 198/500 (40%)
ALP_like 293..571 CDD:293745 138/285 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914953
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.