DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and CG1428

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster

Alignment Length:627 Identity:150/628 (24%)
Similarity:253/628 (40%) Gaps:135/628 (21%)


  Fly   116 VLFINESLASIILNSNGGEY--NCYYQEITRDRK-------------HDSYDKMERKYFSQNYEV 165
            |:|:|.|:..:     .|::  ..:|..|....|             .|..:.:|.|..|::   
  Fly    44 VVFVNTSVCHV-----SGQWKPTAFYSAIEPVNKLRCRMTQLLTAITQDGSNFLEAKRISED--- 100

  Fly   166 PLHVEGLILTCH-------------------------------RLGNESDILQ---SDAYNLIQY 196
                    |:|.                               ::|....|::   ||.:...:|
  Fly   101 --------LSCRYWLKSGHTRNHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKY 157

  Fly   197 R--------PPPKGLSLKPSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIG 253
            .        |.||.:|.: |..|.||::.||||:|.::..|..|.|..||......:..||:::|
  Fly   158 HDVLYFLSPPDPKLMSTE-SSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVG 221

  Fly   254 DNTFPNLLAILTGYNPESAIKKVCNWHEDGCLDRTPFIWHYFRNASYLTAYAEDEA-GINTFNYW 317
            .:...||:..|.|.:..:|...:.:       |...::|..|:...|.|||.||.| ||.:....
  Fly   222 LDANANLVPFLGGKSSRAAGSDILS-------DEKAWLWDSFKMEGYSTAYGEDNAKGILSNRNG 279

  Fly   318 KPGFLEQPTDFYLRPLQKAIESGLNTWKCSDC-SMKYC-IGRRITSSYAYDMARNFANR---FVD 377
            .....:.|.||.|.|:  .:|...:|....|. .|.:| .||:.     .|:.|:|..:   ::.
  Fly   280 DKELPKSPVDFDLTPV--IVEMNNHTRYSIDLKEMIHCTAGRKF-----QDVLRDFVLQLVPYMQ 337

  Fly   378 ERPIWGLFWSNSFSHDSFQMPSKME-DY--VLQYLLDFEADGVFDQSIMVFLSDHGSRYGRLMSL 439
            ..|.:..||.:....:.::....:: .|  :|:.|||  || :.:.:::..:||||.|.|.....
  Fly   338 GMPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLD--AD-ILNNTLLFLMSDHGLRAGEYRMS 399

  Fly   440 PSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYDLHNTLKHIIELGGTPDG----- 499
            ..|..||..|.|....|.|.:.:||.....||.|.:.|.:.|||..||..:|.||...|.     
  Fly   400 LQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVS 464

  Fly   500 ----QTLPKAADCPKCQSLFYPVDETRSCEDAGIPEHFCTCVPYKRLDTQWAKSIAPK--VIGRI 558
                |:.|... .|:..|||.|:.:.|:|:.|.||..||.|.....:.|.....:...  ::..|
  Fly   465 MKRLQSHPPNR-LPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVESI 528

  Fly   559 NEYLA--GRNLSKICSELTLSYIHLTEMKVELDQNFHDDVPRAELGTYRTMFKVKQNSAD--FRA 619
            |:.:.  |:     |.:|.|..:.|.......:::|          .|....:|:.:..:  :.|
  Fly   529 NQLIKPFGQ-----CRQLKLEMVLLAHFLDFGEESF----------VYELRLRVRTSPGNGVYEA 578

  Fly   620 TVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDKMYCIC 661
            ||   .::|.:.:..| |||:..|...|.|:.|...:::|:|
  Fly   579 TV---RLSDVLLLTSP-ISRVSHYLGQSHCIGDPDLQIFCLC 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 132/543 (24%)
ALP_like 212..493 CDD:293745 82/290 (28%)
CG1428NP_610127.1 DUF229 68..547 CDD:281053 125/514 (24%)
ALP_like 180..453 CDD:293745 82/290 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49341
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.