DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and CG11630

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:646 Identity:161/647 (25%)
Similarity:271/647 (42%) Gaps:107/647 (17%)


  Fly    66 YFVESAKCKIPYVDPFASDAMAIFHPEHFETCS---NETALVTPIYDISRQRYVLFINESLASII 127
            |.|::..|::..:.|...|.|.::.....:.|:   |.|:.....|:..|..    :|..||...
  Fly    42 YSVDTKGCRMLTMVPNEYDVMFLWRGLRRDFCASNLNLTSFSNCTYNYLRTE----VNMELAKAR 102

  Fly   128 LNSNGGE-YNCYYQEITRDRKHDSYDKMERKYFSQNYEVPLHVEGLILTCHRLGN-----ESDIL 186
            ......| :.|.|..:.|   |..:|  .|..:|:.:|        :||.   ||     .:||:
  Fly   103 FGVETLESFKCMYYAMER---HTDFD--NRYLYSREFE--------LLTD---GNNTIEPHADII 151

  Fly   187 QSDA-------YNLIQYRPPPKGLSLKPSKRKP-----------SVLMFGIDSLSRINLRRTMPK 233
            :::.       ||.:.:...|....|:.::..|           |||:.|:||:|:::..|:|.:
  Fly   152 RAECFINATSIYNGVHFYVHPTDEWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMAR 216

  Fly   234 VYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPESAIKKVCNWHEDGCLDRTPFIWHYFRNA 298
            ...||......|.:|:|::|::.|.:|:.:|:|.:.:. :|.|.:  ....||..||||..|:.|
  Fly   217 TANFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSGQE-LKDVSS--NLSSLDSCPFIWKVFQKA 278

  Fly   299 SYLTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPL-----QKAIESGLNTWKCSDCSMKYCIGRR 358
            .|.|...||....:.|   ..||.:.||||||||.     .|....||....|::          
  Fly   279 GYETGLGEDNIDKSLF---VKGFRKPPTDFYLRPALLEMWLKTRTDGLFGTHCNE---------- 330

  Fly   359 ITSSYAYDMARNFANRFV----DERPIWGLFWSNSFSHDSFQMPSKMEDYVLQYLLDFEADGVFD 419
             ..:||. :.|.|..:.:    ..|....|:|:....| .|....|::...|:........|:..
  Fly   331 -KDNYAM-VLREFLFKMLPHHTSHRFFTFLWWTQGIDH-LFNYGRKLDQPFLKMFKAIGRSGLLK 392

  Fly   420 QSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYDLH 484
            .::::.:|:||...||......|.:||..|...:..|.|...:||:....|:.|..||.:.:|||
  Fly   393 NTVLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLH 457

  Fly   485 NTLKHIIELGGTPDGQTLPK-------AADCPKCQSLFYPVDETRSCEDAGIPEHFCTCVPYKRL 542
            .||:::..|....|.|...:       ..|.|:..|||.|:.:.|.|..|.||...|.|...:.:
  Fly   458 ATLQNLPNLTSLEDEQLQQRRVDLWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNV 522

  Fly   543 DTQ--WAKSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMK-VELDQNFHDDVPRAELGTY 604
            .|.  :.:..|..:|         |||:|      :.:.|....| :.||:....|..|.....:
  Fly   523 STSDGYVQRAARLII---------RNLNK------MIHTHTPPCKTLYLDRVLTADKWRRIADEH 572

  Fly   605 RTMFKVK----QNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDKMYCIC 661
            ::.|:|:    .....|...|.:.....:|:..   |||::.|.|.|.|:::...:|||.|
  Fly   573 QSEFRVRLIATPGEGQFEGIVRYTGYKLAVDGH---ISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 133/535 (25%)
ALP_like 212..493 CDD:293745 83/301 (28%)
CG11630NP_610124.1 DUF229 66..560 CDD:281053 137/548 (25%)
ALP_like 195..467 CDD:293745 83/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49347
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.