DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and CG32984

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster

Alignment Length:662 Identity:280/663 (42%)
Similarity:415/663 (63%) Gaps:37/663 (6%)


  Fly    12 LCFCLIAIIVILGIKTQNANTKPRVSEVTGSDDTNSDIPPAEEDRNVQDVVRPAYFVESAKCKIP 76
            ||..::.::::..|.:...|                |:...:.:.|     :..::|.|:.|::.
  Fly    18 LCIFILFLLIVWKITSYGVN----------------DVLTIKYNEN-----QKRFYVNSSNCQMA 61

  Fly    77 YVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFINESLASIILNSNGGEYNCYYQE 141
            ||:||.::...::.|::|..|||::.|||..:|...::|||.::|.:...:..|...::.|:||.
  Fly    62 YVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQN 126

  Fly   142 ITRDRKHDSYDKMERK-YFSQNYEVPLHVEGLILTCHRLGNESDILQSDAYNLIQYRPPPKGLSL 205
            ||..:..|.||:|.:| .|:.:|.|||:|:|:::.| |.|:|..|||.||::.:||:.....|.:
  Fly   127 ITYGQSADHYDRMGKKTKFTHDYVVPLNVQGMLVEC-RSGDEKRILQEDAFSFVQYQKTSPNLDI 190

  Fly   206 KPSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPE 270
               .||.||:|:|||::||.||||.||.|:.||...||:|..||||:.|||:||:.:|||||:|.
  Fly   191 ---DRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPN 252

  Fly   271 SAIKKVCNWHEDGCLDRTPFIWHYFRNASYLTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPLQK 335
            ||..::|:..:.||||:.||||...:...||||||||....|.|||.|||||.:|||:|.|||..
  Fly   253 SAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLD 317

  Fly   336 AIESGLNTWKCSDCSMKYCIGRRITSSYAYDMARNFANRFVDERPIWGLFWSNSFSHDSFQMPSK 400
            |:|.......|..|.|.||:|||:.:||.:|..|.|..|:|.:|||||.||||..|||.|.|.|.
  Fly   318 ALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSA 382

  Fly   401 MEDYVLQYLLDFEADGVFDQSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPE 465
            |:..::..||:||.||.|:.:||:|.||||||:|.||.....|||||.|.||||||||||.:||.
  Fly   383 MQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPR 447

  Fly   466 YARALELNRNRLTSNYDLHNTLKHIIELGGTPDGQTLPKAADCPKCQSLFYPVDETRSCEDAGIP 530
            |..||..|:|||:||:|::|||||||.:.|..:....  :.|||:||||||.:.|:|||.:|.||
  Fly   448 YVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKW--SYDCPQCQSLFYELPESRSCSEAAIP 510

  Fly   531 EHFCTCVPYKRLDTQ---WAKSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKV-ELDQN 591
            |.:|||..|:.:...   |  .:|..|:.|||::|...||..:||.|||..:::||::: |.|: 
  Fly   511 EAYCTCHNYEEVQEDHGTW--RMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDE- 572

  Fly   592 FHDDVPRAELGTYRTMFKVKQNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDK 656
             |..:.:. |..|.|.|:|.||.|:|.|||:::..|:.:::.|..|||::.|...::|:.|...|
  Fly   573 -HVSLGKG-LRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQK 635

  Fly   657 MYCICKCDIKDD 668
            ::|||...::::
  Fly   636 LFCICLSKLRNN 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 238/494 (48%)
ALP_like 212..493 CDD:293745 157/281 (56%)
CG32984NP_788014.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914783
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.