DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and CG3123

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster

Alignment Length:659 Identity:179/660 (27%)
Similarity:297/660 (45%) Gaps:85/660 (13%)


  Fly    39 VTGSDDTNSDIPPAEEDR---NVQDVVRPAYFVESAKCKIPYVDPFASDAMAIFHPEHFETCSNE 100
            :|...|.|..|...|..:   |.:|.:    ||.:..|:|....|.:..|::...|.....|..|
  Fly    24 LTSLSDRNKTISIREVPQIYINEEDEL----FVNTTGCRISATKPLSLYALSFMEPIEPVLCRME 84

  Fly   101 TALVTPIYDISRQRYVLFINESLASIILNSNGGEYNCYYQEITR-DRKHDSYDKMERKYF----- 159
            ..:|.   :....|..|..|.|...|:   :..:.:|.|:|..| |..|:.|  :..|:|     
  Fly    85 QLMVA---ETIGDRNYLVRNISRHGIL---SWRQVSCIYREFVRVDDAHNKY--ISLKFFKLTDR 141

  Fly   160 SQNYEVPLHVEGLILTCHRLGNESDILQSDAYNLIQYRPP-PKGL--SLKPSKRKPSVLMFGIDS 221
            ::..||...::.:...|.     .|..:...::::.:.|| |:..  |.:..|||.||::.|:||
  Fly   142 TRYLEVGTGLQHIRTWCW-----VDFGRIIFHDVMYFLPPLPQATNRSTEHQKRKLSVMILGVDS 201

  Fly   222 LSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPESAIKKVCNWHEDGCLD 286
            :|.::..|...:|..|:......|..|||::..||:|||:.:::|.: .|.::..| :|::...|
  Fly   202 ISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLS-VSEMEASC-YHDELNFD 264

  Fly   287 RTPFIWHYFRNASYLTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPLQKAIESGLNTWKCSDCSM 351
            :..|:|:.|:.|.|.|.:|||......|.|.|.||.:||||.|:|||...|||  ::...:...:
  Fly   265 KCNFLWNEFKRAGYSTIFAEDTDTAGLFIYRKRGFQKQPTDIYMRPLMTEIES--HSLYRTTFDL 327

  Fly   352 KYCIGRRITSSYAYDMARNFANRFVD--ERPIWGLF-WSNSFSHDSFQMPSKMEDYVLQYLLDFE 413
            | |.|.|:...:.||    |.::.:.  ||.::..| |:....||.|.....::...|..|....
  Fly   328 K-CTGHRLYGEFYYD----FVSKLIPHMERQLFFSFLWNMHGIHDVFPYAKFVDKDYLSILTRLH 387

  Fly   414 ADGVFDQSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLT 478
            ..||.:.::::|:.|||.|:.:......|..|...|.:....|.|.:.::|......|.|...|.
  Fly   388 EKGVMENTLILFMGDHGLRFDKFARTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERNARSLI 452

  Fly   479 SNYDLHNTLKHIIELGGTPD----GQTLPKAADCPKCQSLFYPVDETRSCEDAGIPEHFCTCVPY 539
            :.:|||.|||.:|.|....|    .:||....:  :..|||.|:.:.|:|:.|.|.:|:|.|...
  Fly   453 TTFDLHETLKDVIHLDRLTDANVRNRTLYLTNE--RGISLFLPIPQNRNCKTAEIKQHYCLCNEL 515

  Fly   540 KRLDT-----QWAKSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKVELDQNFHDDVPRA 599
            |.:.|     |.|.|.|   :.||||.:   .....|..|:|..:....              ||
  Fly   516 KSVSTHESAIQEAASFA---VDRINELI---KPYPQCRVLSLQSVRTAY--------------RA 560

  Fly   600 ELGTYRTMFKVKQ---------NSADFRATVI---FNNVTDSVEVEVPTISRLDSYENVSTCVKD 652
            :..|||..::|.|         ...:|.|||:   .|.....:::..| ::|.|.|.:.:.||::
  Fly   561 KSSTYRGNYRVSQVMVRLKTTPGDGNFDATVLITMLNGEKTDMKLGGP-VTRTDRYAHQAYCVQN 624

  Fly   653 KTDKMYCIC 661
            ...:|||.|
  Fly   625 YRIEMYCYC 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 144/511 (28%)
ALP_like 212..493 CDD:293745 87/284 (31%)
CG3123NP_608716.1 DUF229 74..555 CDD:281053 144/511 (28%)
ALP_like 192..468 CDD:293745 88/285 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49353
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.