DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and F15H10.7

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:655 Identity:171/656 (26%)
Similarity:274/656 (42%) Gaps:124/656 (19%)


  Fly    71 AKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFINESLA---SIILNSNG 132
            ::|.||..||:....::.:        |..:.||.....:  |....|.|..|.   .:|.|:  
 Worm    60 SECVIPDADPWDPSILSYY--------SKPSPLVCSTMQV--QAVKSFNNGILTFEPQVIKNA-- 112

  Fly   133 GEYNCYYQEITRDRKHDSYDKMERKYFSQNYEVPLHV----------EGLILTCHRLGNESD-IL 186
               .||...|..|......|.:..|      .|||::          |...:||     ||| :|
 Worm   113 ---RCYKTGIRHDENVTDLDVIYEK------PVPLNLTHTSSIKISDEVFQITC-----ESDNLL 163

  Fly   187 QSDAYNLIQYRPPPKGLSLK------PSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFE 245
            :|:.:.....:..||..::|      .:...|||:|.|:||:||.|..|.|.|.||::...|:.:
 Worm   164 KSEIFKYHYTQIVPKSSNIKNKVIEQSTSDFPSVIMIGLDSMSRGNFVRQMQKTYKYMKEAGFID 228

  Fly   246 QQGYNKIGDNTFPNLLAILTGYN----PESAIKKVCNWHEDGCLDRTPFIWHYFRNASYLTAYAE 306
            .:|:.||.|||:.||||||||..    .|.:.:...:||.  ..|...|||..|.:..|.|.:||
 Worm   229 MEGHMKIHDNTYGNLLAILTGKRGVGVKEFSTEINESWHI--AFDEFDFIWKTFSDNGYATLFAE 291

  Fly   307 DEAGINTFNY--WKPGFLEQPTDFYLRPL----------QKAIESGLNTWKCSDCSMKYCIGRRI 359
            |...|.||.|  ...|||:||||.|:||.          ::::.|      |.|.:.::.|..:.
 Worm   292 DRPDIGTFTYKNMLEGFLKQPTDHYIRPFWISAFWSLISRRSVAS------CYDSTPQHKIQLKY 350

  Fly   360 TSSY--AYDMARNFANRFVDERPIWGLFWSNSFSHDSFQMPSKMEDYVLQYLLDFEA-----DGV 417
            ...:  .||..|.||        .|   ||...||....:..|::|       |||.     :..
 Worm   351 LEEFLEKYDKKRKFA--------FW---WSQDMSHGFLNLIGKVDD-------DFEKFFKNNEKR 397

  Fly   418 FDQSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYD 482
            .:.||::..||||.||.::.....|.:|.|:|...|.:|...:.:||:....|.:|...:|:.:|
 Worm   398 MEDSIIIVFSDHGHRYDKIRETVIGRIESRMPFHSIRIPDGIKKKYPQIVENLMVNSKLMTTQFD 462

  Fly   483 LHNTLKHIIELGGTPDGQTLPK--AADCPKCQSLFYPVDETRSCEDAGIPEHFCTCVPYKRLDTQ 545
            ::::|:.|      ..|:...|  ..|..:..|.|.|..:...|.:||||..||.|.....:...
 Worm   463 VNDSLRKI------ATGKVGEKWTQTDRKRSYSYFDPFPKRIGCYEAGIPSDFCPCFSEIEIPKS 521

  Fly   546 WAKSIAPKVIGRINEYLAGRNLSK--------------ICSELTLSYIHLTEMKVELDQNFHD-- 594
            .||..|.:::..:|:.|  .|..|              :|:.:.:..:..:.:::.:.....|  
 Worm   522 EAKEAAVELMRIVNDLL--ENTEKTEEYEPDSKELTEYMCTPMEIQNVEFSSVRLPMLSVLKDVK 584

  Fly   595 --DVPRAELG-TYRTMFKVKQNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDK 656
              |.|..... .|..:.:.|..|.....:.:.:|:..:....:..:.|.:.|.|.|.||.|:..|
 Worm   585 SEDTPLQSFSLQYHVVVRAKAPSNALLESTLEHNLKTNTWSSLGEVERNNKYGNTSFCVNDRILK 649

  Fly   657 MYCIC 661
            ..|.|
 Worm   650 KICHC 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 149/549 (27%)
ALP_like 212..493 CDD:293745 98/304 (32%)
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 149/541 (28%)
ALP_like 195..472 CDD:293745 98/309 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.