DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9988 and R03G8.3

Sequence 1:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans

Alignment Length:707 Identity:155/708 (22%)
Similarity:275/708 (39%) Gaps:143/708 (20%)


  Fly    15 CLIAIIVILGIKTQNANTKPR-----VSEVTGSDDT-----NSDIPPAEEDRNVQDVVRPAYFVE 69
            |....:|:||....:....|:     ...::|:..:     .|::.|.::               
 Worm    21 CFAMYLVLLGFTMFSPLLSPQQYLGLYQPISGNIPSKVVMNKSEVEPWDQ--------------- 70

  Fly    70 SAKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVL-FINESLASIILNSNGG 133
               |::|..|.:..:.:...:.|           |.||.:.::.|..| |:|        |.:.|
 Worm    71 ---CELPQYDIWDDEILPYLNME-----------VNPISNCNKSREPLTFLN--------NGSWG 113

  Fly   134 EYNCYYQEITRDRKHDSYDKMERKYFSQNYEV---------PLHVEGLILTCHRLGNESDILQSD 189
            ..|...:.|.|.|.|      .||  |:.|.|         |::.|.:...|      :| .:.|
 Worm   114 VVNKKTKLICRARCH------TRK--SERYNVIGNWTYTPGPINCEVVEAVC------AD-GKKD 163

  Fly   190 AYNLIQYR---PPPKGLSLKPSKRKP-SVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGY- 249
            .|..:..:   .|||..::|.|:.|. .|.:..:||||....:|::.:...::|.........| 
 Worm   164 VYGFLHTQVIATPPKQPTVKVSELKNYDVTVIMLDSLSFTQAKRSLLRTISYMTNHMDAVLFPYI 228

  Fly   250 NKIGDNTFPNLLAILTGYNPESAIKKV-------CNW-HEDGC---LDRTPFIWHYFRNASYLTA 303
            ||:|||:.||..|:..|.:.|...:.:       .:| |...|   .|....::..::|..|.|.
 Worm   229 NKVGDNSRPNGAALWFGKSLEKLDRSLFEEENVPVDWSHAYMCHVYKDNETSLFKEYQNYGYKTL 293

  Fly   304 YAEDEAGINTFNYWK--PGFLEQPTDFYLRPLQKAIE---SGLNTWKCSDCSMKYCIGRRITSSY 363
            .|||.|. .|.| |.  .||.:.|.|..:||.|.|:|   .|....|....:.|||   |.....
 Worm   294 MAEDWAE-GTLN-WPNCKGFDKPPIDHLMRPFQNALERANHGEPLTKSHLKNQKYC---REDHHT 353

  Fly   364 AYDMARNFANRFVDERPI-WGLFWSNSFSHDSFQ-MPSKMEDYVLQYLLDFEADGVFDQSIMVFL 426
            ..|....|.|.:.|:... |  .|::...|||.. .|...:|: .::|:.....  .|.|.:.|:
 Worm   354 LLDYLSQFINAYPDQNKFRW--IWASILGHDSENGFPHSDKDF-HKFLIKHREQ--LDNSFVFFM 413

  Fly   427 SDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYDLHNTLKHII 491
            .|||.|:|.:.....|.|:...|.:.:.:|...| |.......:..|..::.:::|...|:..|:
 Worm   414 GDHGLRFGNVRKTFVGTLDVSNPFLAVSIPKNLR-QTTGLLNVMRENAQKIQTHFDTRATMLDIL 477

  Fly   492 ELGGTPDGQTLPKAADCPKCQSLFYP-----------VDETRSCEDAGIPEHFCTCVPYK---RL 542
            :         ...|::......|..|           .|..|:|.:..||..:|.|...|   ..
 Worm   478 K---------YQSASNFTDLDPLIIPGEKGYSYIRTQPDILRNCRNMPIPMQYCICQFNKTQVST 533

  Fly   543 DTQWAKSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKVELDQNFHDDVPRAELGTYRTM 607
            .::.||.:...|...:|..:.....:..|.::.:.  |:..: ::.||.|...:      .|..:
 Worm   534 KSETAKGVGEAVALAVNNEIEEGKFTDKCVKMKVD--HVVSL-LQFDQKFKGSM------LYTAV 589

  Fly   608 FKV-KQNSADFRATVIFNNVTDSVEVEV-PTISRLDSYENVSTCVKDKTDKMYCICK 662
            .:: |.:.|.::|.|   .:.::.||:| ..:.|.:.|.:.:.|:..:..:.||.||
 Worm   590 VEMTKPSKAVYKANV---KILENGEVKVLGMVERSNKYGSTAYCIGSEHHRPYCYCK 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9988NP_651625.1 DUF229 90..580 CDD:281053 125/537 (23%)
ALP_like 212..493 CDD:293745 77/301 (26%)
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 124/523 (24%)
ALP_like 190..480 CDD:293745 77/310 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50023
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.