DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and CADM2

DIOPT Version :8

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens

Alignment Length:183 Identity:40/184 (22%)
Similarity:71/184 (39%) Gaps:42/184 (23%)


  Fly    63 VLMGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPREAKPTFVF----AVAGINVDL--ANSD 121
            |:.|..|.|:|:.|  |....:::|           ...|:.|..|    |:....::|  |:..
Human    48 VVEGGTAILTCRVD--QNDNTSLQW-----------SNPAQQTLYFDDKKALRDNRIELVRASWH 99

  Fly   122 ATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRS--AHMQVIELPK-------DDPVMQVDKKVI 177
            ..|:::..|:....|.|.|.      ||...:::  |::.|:.:|:       ..|||:      
Human   100 ELSISVSDVSLSDEGQYTCS------LFTMPVKTSKAYLTVLGVPEKPQISGFSSPVME------ 152

  Fly   178 GVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDTYEGSTTYSSLD 230
              .|..:..|....|.|.|:|.|..|..:|:.....:......:..|..|:||
Human   153 --GDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLD 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 IG_like 63..154 CDD:214653 21/97 (22%)
Ig 66..143 CDD:299845 18/83 (22%)
Ig 178..>237 CDD:299845 13/54 (24%)
CADM2XP_016861551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.923 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.