DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or85f

DIOPT Version :8

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster

Alignment Length:376 Identity:70/377 (19%)
Similarity:136/377 (36%) Gaps:114/377 (30%)


  Fly     4 DKFLRLQSALFRLLGLELLHEQDVGHR----YPWRSICCILSVASFMPLTIAFGLQNVQNVEQLT 64
            :.|.||.:.:|.::|.::|.......|    :.:|.:|    :||.   .:..|:...:.||..|
  Fly     9 EDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLC----LASH---GVCVGVMVFRMVEAKT 66

  Fly    65 DSLCSVLVDLLALCKIGLFLWLYKDFKFLIG---QFYCVLQTET----HTAVAEMIVTRESRR-- 120
            ....|:::....|            ..::|.   :|..|||...    ::.:||:.......|  
  Fly    67 IDNVSLIMRYATL------------VTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIY 119

  Fly   121 ----DQFISAMYAY---CFITAGLSACLMSPLSMLISYQRTG---------------ELQPKFPF 163
                |.:.:..:.|   .:|.:.:...:...::.:|:|....               |..|.:.:
  Fly   120 HRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVWIY 184

  Fly   164 PSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEG--R 226
            .|:|..:.:..:..:||   |:.|.:.:         |:..:..||            ||.|  |
  Fly   185 ISIYALEWLHSTQMVIS---NIGADIWL---------LYFQVQINL------------HFRGIIR 225

  Fly   227 NTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQPALLFYAA 291
            :..:...::||               ::..|..|.:.|...:||..|...|: .|...:||....
  Fly   226 SLADHKPSVKH---------------DQEDRKFIAKIVDKQVHLVSLQNDLN-GIFGKSLLLSLL 274

  Fly   292 FTAAVVGQVSIY--------------CFCGSS---IHSECQLFGQAIYESS 325
            .||||:..|::|              .|.|:|   ::..| .:||.:.:.|
  Fly   275 TTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVC-YYGQQVLDLS 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 58/318 (18%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 55/311 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.