DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Orco

DIOPT Version :8

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster

Alignment Length:450 Identity:85/450 - (18%)
Similarity:152/450 - (33%) Gaps:128/450 - (28%)


  Fly    45 FMPLTIAFGLQNVQ-NVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVL----QTE 104
            |:.:...|.|.|:. |.|::.:...:.:..|.....|..|::|..:.|    .||..|    |..
  Fly    52 FLLMQFTFILVNMALNAEEVNELSGNTITTLFFTHCITKFIYLAVNQK----NFYRTLNIWNQVN 112

  Fly   105 THTAVAE------MIVTRESRRDQFISAMYAYCFITAGLSACLM-SPLSMLISYQRTGELQ---P 159
            ||...||      .|...:.|:..|:..:......||..:.... ..:.|::.::....:.   |
  Fly   113 THPLFAESDARYHSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIP 177

  Fly   160 KFPFPSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCS--------LSH--------- 207
            :.|..|.|||:......|:||:.:.:...|...:.:...|.:|||        |.|         
  Fly   178 RLPIKSFYPWNASHGMFYMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLM 242

  Fly   208 -----------NLCALFQI----ARHKMMHFE--------------------------------- 224
                       |..|||:.    ::.:::|.|                                 
  Fly   243 ELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSF 307

  Fly   225 ------------GRN----TKETH-----------ENLKHVFQLYALCLNLGHFLNEYFRPLICQ 262
                        |.|    ||:..           |..|||.:|.|.   :|   :.|...|:..
  Fly   308 GGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAA---IG---DTYGAALLLH 366

  Fly   263 FVAASLHLCVLCYQLS----ANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYE 323
            .:.:::.|.:|.||.:    .|:....::.|..:..|   ||..:|..|:.:..|.....:|.|.
  Fly   367 MLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALA---QVFHFCIFGNRLIEESSSVMEAAYS 428

  Fly   324 SSWPHLLQENLQLVSSLKIAMMRSSLGCPIDG-YFFEANRETLITIVRTAISYVTLLRSL 382
            ..|....:|....|   :|...:......|.| .||..:.:...:::...::|..:|..|
  Fly   429 CHWYDGSEEAKTFV---QIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQL 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 78/423 (18%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 76/417 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.