DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or49b

DIOPT Version :8

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster

Alignment Length:392 Identity:77/393 (20%)
Similarity:145/393 (37%) Gaps:72/393 (18%)


  Fly    21 LLHEQDVGHRYPWRSICCILSVASFMPLT-IAF------GLQN-VQNVEQLTDSLCSVLVDLLAL 77
            ||::::: .||    :|  :.:|||...| |.:      ||.. ::|...|...:.:||...|.|
  Fly    20 LLYDKNL-RRY----VC--IGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLL 77

  Fly    78 CKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQF--ISAMYAYCFITAGLSAC 140
            .....:|.|.:.   |...:|.:|.. ..:.::|::       ||.  :..:.|...:..|:...
  Fly    78 ADHDRYLALIQK---LTEAYYDLLNL-NDSYISEIL-------DQVNKVGKLMARGNLFFGMLTS 131

  Fly   141 LMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISYF--WNVCAALGVALPTVCVDTLFC 203
            :...|..|.|.:|.      .||.|..|    .|:.|...|:  |.:...| :.....|:...:.
  Fly   132 MGFGLYPLSSSERV------LPFGSKIP----GLNEYESPYYEMWYIFQML-ITPMGCCMYIPYT 185

  Fly   204 SLSHNLCALFQIARHKMMH-----------FEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFR 257
            ||...| .:|.|.|.|.:.           :..|:.:|..|.:       ..|:.....:.||..
  Fly   186 SLIVGL-IMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEI-------IACIRYQQSIIEYMD 242

  Fly   258 PL--------ICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSEC 314
            .:        :.:.:|.|..||.|.:.|........|:....:...::.|:....:..:.:..:.
  Fly   243 HINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQN 307

  Fly   315 QLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPI-DGYFFEANRETLITIVRTAISYVTL 378
            .....|.||:.|   ...::.|..::...|||:.....| .|.......|....::.|..::.|:
  Fly   308 LAVATAAYETEW---FTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTV 369

  Fly   379 LR 380
            |:
  Fly   370 LK 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 63/337 (19%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 64/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.