DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or45b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:420 Identity:84/420 - (20%)
Similarity:153/420 - (36%) Gaps:99/420 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FRLLGLELLHEQDVGHRYPW-------RSICCILSVASFMPLTIAFGLQNVQN--VEQLTDSLCS 69
            |.||||....||...|.. |       .:.||   .|.|:     ||..:::.  |:.: |:.|.
  Fly    24 FGLLGLRFGKEQSWLHLL-WLVFNFVNLAHCC---QAEFV-----FGWSHLRTSPVDAM-DAFCP 78

  Fly    70 VLVDLLALCKIGLFLW-------LYKDFKFLIGQFYCVLQTETHTAVAE----MIVTRESRRDQF 123
            :......|.|:|...|       |....:.|||:  ...:.::...||:    ::|||       
  Fly    79 LACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGE--QEKREDSRRKVAQRSYYLMVTR------- 134

  Fly   124 ISAMYAYCF--ITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVY-------PWDNMKLSNYII 179
             ..|..:..  ||.| :..|.|...|.:  :|..|.:...||..::       ||       :.:
  Fly   135 -CGMLVFTLGSITTG-AFVLRSLWEMWV--RRHQEFKFDMPFRMLFHDFAHRMPW-------FPV 188

  Fly   180 SYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHF-------EGRNTK-------- 229
            .|.::..:...........|..|...:..:..|.|..|:.:...       ..|.:|        
  Fly   189 FYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLAD 253

  Fly   230 --ETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLC-----VLCYQLSANILQPALL 287
              :.|..::.:.:         .|......|....||:|||.:.     :|.|. ..||::    
  Fly   254 IVDRHNEIEKIVK---------EFSGIMAAPTFVHFVSASLVIATSVIDILLYS-GYNIIR---- 304

  Fly   288 FYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCP 352
             |..:|..|...:.:||:.|:.:.:|....|:|.|.|:|....:|..:.|.   :.::|:.....
  Fly   305 -YVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVF---LIILRAQRPIT 365

  Fly   353 IDGYFFEANRETLITIVRTAISYVTLLRSL 382
            :...||..:.....::::...|.|.|.:::
  Fly   366 VRVPFFAPSLPVFTSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 66/356 (19%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 66/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.