DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or65b

DIOPT Version :8

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster

Alignment Length:364 Identity:66/365 (18%)
Similarity:130/365 (36%) Gaps:120/365 (33%)


  Fly    24 EQDVGHRYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYK 88
            |:.:.:|..|.::..|..|..|  .:::||         ||:|:             |..:.:.:
  Fly    47 ERLLPYRSKWHTLVYIQMVIFF--ASMSFG---------LTESM-------------GDHVQMGR 87

  Fly    89 DFKFLIGQFYCVLQT--------ETHTAVAEM-------------IVTRESRRDQFISAMYAYCF 132
            |..|::|.|:.:.:|        |....::::             :..:..:|..|:.|.    |
  Fly    88 DLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAF----F 148

  Fly   133 ITAGLSACLMSPLSMLISYQRTGEL---QPKFPFPSVYP--WDNMKL---SNYII----SYF--- 182
            :....|..|...|.:||    |..:   |...||.:.:|  |....|   |:.||    |||   
  Fly   149 LATSWSFFLCILLLLLI----TSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVY 209

  Fly   183 ---WNVC---------AALGVALPTVCVDTLFCSLSHNLCALFQIARH----KMMHFEGRNTKET 231
               |.:|         |.:...:..:|::            |.||.||    :.:..|.....:.
  Fly   210 CLTWLLCIEGLSICIYAEITFGIEVLCLE------------LRQIHRHNYGLQELRMETNRLVKL 262

  Fly   232 HENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQ-------PALLF- 288
            |:.:..:...          .|:.|...:...:..:..|      :|.::|:       |.::. 
  Fly   263 HQKIVEILDR----------TNDVFHGTLIMQMGVNFSL------VSLSVLEAVEARKDPKVVAQ 311

  Fly   289 YAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWP 327
            :|......:|.:|::.:||..:..:.....:|.||:..|
  Fly   312 FAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDP 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 58/330 (18%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 54/305 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.