DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or65a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:418 Identity:75/418 - (17%)
Similarity:154/418 - (36%) Gaps:105/418 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RLLGLELLHEQDVGHRYP----WR---SICCILSVASFMPLTIAFGL-QNVQNVEQLTDSLCSVL 71
            :.||..:..||   .|.|    |:   ||....::||     :.:|: :::.::..|...|..::
  Fly    47 KALGFYMNSEQ---RRLPRIVAWQYFVSIQLATALAS-----LFYGISESIGDIVNLGRDLVFII 103

  Fly    72 VDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIV--TRESRRDQFISAMYAYCFIT 134
            ..:....::..|.....:...:|.    .|:...|.::.....  .:|::|..|:..|       
  Fly   104 TIIFICFRLVFFAQYAGELDVIID----ALEDIYHWSIKGPATKEVQETKRLHFLLFM------- 157

  Fly   135 AGLSACLMSPLSMLISY------------QRTGELQPKFPF----PSVYP--------------- 168
                |.:::..|.||.:            .:|......:||    ||.:|               
  Fly   158 ----ALIITWFSFLILFMLIKISTPFWIESQTLPFHVSWPFQLHDPSKHPIAYIIIFVSQSTTML 218

  Fly   169 ----WDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTK 229
                |..: :.|..:|.|:.:.:||.|    :|::.      .||..|. :....|::.|.....
  Fly   219 YFLIWLGV-VENMGVSLFFELTSALRV----LCIEL------RNLQELC-LGDEDMLYRELCRMT 271

  Fly   230 ETHENLKHVFQLYALCLNLGHFLN-EYFRPLICQFVAASLHLCVLCYQLSANILQPAL-LFYAAF 292
            :.|:      |:..|.....|..| .:...::..|:..||.|    :::.|....|.: :.|...
  Fly   272 KFHQ------QIILLTDRCNHIFNGAFIMQMLINFLLVSLSL----FEVLAAKKNPQVAVEYMII 326

  Fly   293 TAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQ------LVSSLKIAMMRSSLGC 351
            ....:|.:|.:...|.....|.:....|:||:..|::..:::.      :..:.|..:|::|...
  Fly   327 MLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFP 391

  Fly   352 PIDGYFFEANRETLITIVRTAISYVTLL 379
            |.       |.|..:.|::...|.:|:|
  Fly   392 PF-------NLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 60/357 (17%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 54/300 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.