DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and Uqcrb

DIOPT Version :8

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080495.1 Gene:Uqcrb / 67530 MGIID:1914780 Length:111 Species:Mus musculus

Alignment Length:92 Identity:61/93 (66%)
Similarity:73/93 (78%) Gaps:0/93 (0%)


  Fly    18 KWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTK 82
            ||.||.:|||:.||.|||.|:|.|||.||:||||..||::|.:||.|||.|:|...||||:||||
Mouse    19 KWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTK 83

  Fly    83 YEEDIKYLEPYLNEVQKEREEREEWSK 109
            ||||..||||||.||.:||:|||||:|
Mouse    84 YEEDKFYLEPYLKEVIRERKEREEWAK 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 57/87 (66%)
UqcrbNP_080495.1 UCR_14kD 10..106 CDD:280439 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C277728295
eggNOG 1 0.900 E1_KOG3440
Hieranoid 1 1.000
Homologene 1 1.000 H38164
Inparanoid 1 1.050 134 1.000 Inparanoid score I4534
Isobase 1 0.950 0 Normalized mean entropy S1136
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003426
OrthoInspector 1 1.000 T616434
orthoMCL 1 0.900 OOG5_129503
Panther 1 1.100 O PTHR12022
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1049
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.