DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and UQCR-14

DIOPT Version :8

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster

Alignment Length:111 Identity:95/112 (85%)
Similarity:102/112 (91%) Gaps:0/112 (0%)


  Fly     1 MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRA 65
            ||.|:||.||||.|.||:||||:||||||||:|||||||||||.||||||||||||||||||:||
  Fly     1 MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRA 65

  Fly    66 LHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKEREEREEWSKTH 111
            |||||||||||||||||||||:|||||||.||.|||||||:|.|.|
  Fly    66 LHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREEREDWEKIH 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 83/93 (89%)
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:280439 74/82 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275025650
eggNOG 1 0.900 E1_KOG3440
Homologene 1 1.000 H38164
Inparanoid 1 1.050 58 1.000 Inparanoid score I2501
Isobase 1 0.950 0 Normalized mean entropy S1136
OrthoDB 1 1.010 D1606436at2759
OrthoFinder 1 1.000 FOG0003426
orthoMCL 1 0.900 OOG5_129503
Panther 1 1.100 P PTHR12022
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1049
109.870

Return to query results.
Submit another query.