DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and qcr7

DIOPT Version :8

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_588364.1 Gene:qcr7 / 2539439 PomBaseID:SPCC737.02c Length:137 Species:Schizosaccharomyces pombe

Alignment Length:88 Identity:46/89 (52%)
Similarity:59/89 (66%) Gaps:2/89 (2%)


  Fly    20 AY-NMSGFNQYGLYRDD-CLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTK 82
            || ::||:.:|||..|| .|.||:|..:|:.|||:....:|.|||.||:.||:...||||.:|||
pombe    26 AYVHLSGYRKYGLRYDDLMLEENDDTQKALSRLPKMESYDRVYRIRRAMQLSIENKILPKSEWTK 90

  Fly    83 YEEDIKYLEPYLNEVQKEREERE 105
            .|||..||.|.|.||..||:|||
pombe    91 PEEDYHYLRPVLAEVIAERKERE 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 45/87 (52%)
qcr7NP_588364.1 UCR_14kD 16..113 CDD:280439 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1727
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003426
OrthoInspector 1 1.000 T631665
orthoMCL 1 0.900 OOG5_129503
Panther 1 1.100 O PTHR12022
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1049
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.