DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and T02H6.11

DIOPT Version :8

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_493795.1 Gene:T02H6.11 / 173459 WormBaseID:WBGene00020181 Length:130 Species:Caenorhabditis elegans

Alignment Length:102 Identity:38/103 (37%)
Similarity:65/103 (63%) Gaps:5/103 (5%)


  Fly    12 VFSKLGKWAY-NMSGFNQYGLYRDDCLYE-NEDVAEAVRRLPRK---LYDERNYRILRALHLSMT 71
            :.|.|.|:|: |:.|..:|||...|..:| ..:|.||:|||..:   ::|:|..|:.||..|::.
 Worm    18 IASTLRKFAWSNLWGGREYGLQFHDTYFEPAPEVTEALRRLNLQEPHVFDQRKIRLSRAHTLALH 82

  Fly    72 KTILPKEQWTKYEEDIKYLEPYLNEVQKEREEREEWS 108
            ...|||.:||:::::..||:|||:|::.|::.|.|.|
 Worm    83 GEKLPKAEWTQWDQESWYLKPYLDEIEAEKKARAETS 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 36/98 (37%)
T02H6.11NP_493795.1 UCR_14kD 19..116 CDD:280439 36/97 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275025842
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3914
Isobase 1 0.950 0 Normalized mean entropy S1136
OMA 1 1.010
OrthoDB 1 1.010 D1606436at2759
OrthoFinder 1 1.000 FOG0003426
OrthoInspector 1 1.000 T374656
orthoMCL 1 0.900 OOG5_129503
Panther 1 1.100 O PTHR12022
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1049
TreeFam 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.