DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and LOC101732809

DIOPT Version :8

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_004915192.1 Gene:LOC101732809 / 101732809 -ID:- Length:111 Species:Xenopus tropicalis

Alignment Length:94 Identity:57/95 (60%)
Similarity:76/95 (80%) Gaps:0/95 (0%)


  Fly    16 LGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQW 80
            |.||.||::|||:.||.|||.:||::||.|||||||.|:||:|.:||.|||.|::.:..|||:||
 Frog    17 LRKWYYNVAGFNKLGLMRDDTIYEDDDVKEAVRRLPPKVYDDRIFRIKRALDLNIRQQHLPKQQW 81

  Fly    81 TKYEEDIKYLEPYLNEVQKEREEREEWSK 109
            .|||||:.||||||.||.:||:|:::|.|
 Frog    82 IKYEEDVHYLEPYLKEVIRERKEKQDWMK 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 55/89 (62%)
LOC101732809XP_004915192.1 UCR_14kD 10..106 CDD:280439 55/89 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H38164
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1606436at2759
OrthoFinder 1 1.000 FOG0003426
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.