DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BCAS2 and Bcas2

Sequence 1:NP_651596.1 Gene:BCAS2 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_080878.2 Gene:Bcas2 MGIID:1915433 Length:225 Species:Mus musculus

Alignment Length:206 Identity:123/207 (59%)
Similarity:151/207 (73%) Gaps:0/207 (0%)


  Fly     1 MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFE 65
            :||||:||||||.|.||:..||||:|.|:||||.||||||||||.:|..|..|.|||.:|.||||
Mouse     7 VAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFE 71

  Fly    66 RIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWK 130
            |:..|.|:|.|||||||||.|.||:.::::||||.:.|||||||||.||..|||||..:|..|||
Mouse    72 RLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWK 136

  Fly   131 SYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVE 195
            .|.|....|...||.:||:|:|.|||:|||||..|..||.:||.:|::||.|||||||||...|:
Mouse   137 VYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQ 201

  Fly   196 LEKIVHAARQQ 206
            ||..::..:||
Mouse   202 LENEIYQIKQQ 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 119/202 (59%)
Bcas2NP_080878.2 BCAS2 11..214 CDD:310362 120/203 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260316325
eggNOG 1 0.900 E1_KOG3096
Hieranoid 1 1.000
Homologene 1 1.000 H4291
Inparanoid 1 1.050 248 1.000 Inparanoid score I3225
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005310
OrthoInspector 1 1.000 T1083835
orthoMCL 1 0.900 OOG5_129447
Panther 1 1.100 LDO PTHR13296
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5336
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.