DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BCAS2 and Bcas2

Sequence 1:NP_651596.1 Gene:BCAS2 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001099928.1 Gene:Bcas2 RGDID:1306485 Length:225 Species:Rattus norvegicus

Alignment Length:206 Identity:122/207 (59%)
Similarity:151/207 (73%) Gaps:0/207 (0%)


  Fly     1 MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFE 65
            :||||:||||||.|.||:..||||:|.|:||||.||||||||||.:|..|..|.|||.:|.||||
  Rat     7 VAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFE 71

  Fly    66 RIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWK 130
            |:..|.|:|.|||||||||.|.||:.::::|||:.:.|||||||||.||..|||||..:|..|||
  Rat    72 RLAARQPIELLSMKRYELPAPSSGQKNDITAWQDCVNNSMAQLEHQAVRIENLELMSQHGCNAWK 136

  Fly   131 SYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVE 195
            .|.|....|...||.:||:|:|.|||:|||||..|..||.:||.:|::||.|||||||||...|:
  Rat   137 VYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGAKLREMESNWVSLVSKNYEIERTIVQ 201

  Fly   196 LEKIVHAARQQ 206
            ||..::..:||
  Rat   202 LENEIYQIKQQ 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 118/202 (58%)
Bcas2NP_001099928.1 BCAS2 12..214 CDD:283380 118/202 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260315283
eggNOG 1 0.900 E1_KOG3096
Hieranoid 1 1.000
Homologene 1 1.000 H4291
Inparanoid 1 1.050 246 1.000 Inparanoid score I3138
OMA 1 1.010
OrthoDB 1 1.010 D1607056at2759
OrthoFinder 1 1.000 FOG0005310
OrthoInspector 1 1.000 T1087389
orthoMCL 1 0.900 OOG5_129447
Panther 1 1.100 LDO PTHR13296
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.