DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BCAS2 and T12A2.6

Sequence 1:NP_651596.1 Gene:BCAS2 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_498359.2 Gene:T12A2.6 WormBaseID:WBGene00020440 Length:689 Species:Caenorhabditis elegans

Alignment Length:231 Identity:43/232 (19%)
Similarity:84/232 (36%) Gaps:61/232 (26%)


  Fly    21 GVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFERIQNRLPMETLSMKRYELPP 85
            |..|:|.....:..:.::...::.:.|||    .|:..::.|.....:.....:.|....:|...
 Worm   336 GSVENAKLKYNQLIQTFQAFPHFKELLPL----AFDITMLLNRTTNTEGVTGSQLLFSLVFEQKF 396

  Fly    86 PPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWKSYLEVFTAMQAKAQLQLQQL 150
            .||..:.| |...:::|....     :..::|......:||     .:||.    ||.:::|.:.
 Worm   397 TPSNMIFE-STKTKSLETMQT-----FFGAINFSKTSGFGT-----LMEVL----AKEKIRLNKF 446

  Fly   151 KKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVS--KNYEIETECVELEKIVHAARQQLRKITPP 213
            :..:..::..|                   :||.  :.|...|...|:.|.|.:|.|.:|.|:  
 Worm   447 RDYVSKLDDDR-------------------ILVRNLRKYFDVTTTEEIGKKVRSALQSIRDIS-- 490

  Fly   214 PSANDTAPTPEYTNGFDQN-------DLAESNGSSS 242
             |.|:           |.|       |:..|:.|:|
 Worm   491 -STNE-----------DLNEILKTVRDIYRSSNSAS 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 33/189 (17%)
T12A2.6NP_498359.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13296
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.