DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BCAS2 and T12A2.5

Sequence 1:NP_651596.1 Gene:BCAS2 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_498357.1 Gene:T12A2.5 WormBaseID:WBGene00020439 Length:994 Species:Caenorhabditis elegans

Alignment Length:294 Identity:64/295 (22%)
Similarity:108/295 (37%) Gaps:90/295 (31%)


  Fly    20 VGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFER---IQNRLPMETLSMKRY 81
            ||..::..:.:....:.| ||  :.|.|||    .|:..|:.|:.:.   :...:|.    .|.:
 Worm   262 VGNAKTKCSQMTHAFQAY-PT--FKDLLPL----AFDITLLLNQTDETTGVPGYIPF----FKFF 315

  Fly    82 ELPPPPSGKLSEVSA-WQEAIENS-----MAQLEHQWVRSLNLELMLDYGTEAWKSYLEVFTAMQ 140
            .....|:|..:.|.| :::.::.|     :..||::   ...|...||......:||.|||.|||
 Worm   316 SQEDVPTGLKTIVEALFKKKVKRSDMTMDVTNLENE---EKPLFQDLDKLVTTDESYQEVFLAMQ 377

  Fly   141 ------------AKAQL------QLQQLKKDI-------QDV-NWQRKQ----------AQTQAG 169
                        ||.|.      .|:.::..|       ||: .|....          .::::.
 Worm   378 MLLEIDNLDVINAKCQFIDSFYSGLEYIEPVIEAFGVSTQDIRKWNEATIFVDALVQLLKESRSH 442

  Fly   170 ERL------------------RSLEAHWVLLVSKNYEIE-----TECVELEKIVHAARQQLRKIT 211
            |.|                  .|||....::|..|.:.|     |..:.|..||..|..| ||.:
 Worm   443 ENLMKFLAFHGKFTTVKDDPSASLELIGDIIVYLNKKPEQIFNLTLILGLVIIVGFASGQ-RKTS 506

  Fly   212 PPPSANDTAPTPEYTN----GFDQ---NDLAESN 238
            .|..:::...:.:|.|    .||:   ..||:.|
 Worm   507 EPKKSSNPFASKKYNNPLHAEFDEPSAEALADLN 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 54/256 (21%)
T12A2.5NP_498357.1 aProt_lowcomp <492..>726 CDD:274073 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13296
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.