DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS22 and MRPS22

DIOPT Version :9

Sequence 1:NP_524537.1 Gene:mRpS22 / 43345 FlyBaseID:FBgn0039555 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_064576.1 Gene:MRPS22 / 56945 HGNCID:14508 Length:360 Species:Homo sapiens


Alignment Length:333 Identity:100/333 - (30%)
Similarity:166/333 - (49%) Gaps:48/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QPLFTDAETQRLLQSMTQLNLDKVYRKRTVPDNSSETKFMSNEQLDNEFQNLVVRAQQILQMPPI 104
            :|.|.|.|.|.:|..||.|||.|.::...........|.|:..||:...:..|..|:..|:|||:
Human    67 KPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPV 131

  Fly   105 VQIKKDVERVIAKDTALKDFANSKFVFTDITFGRRQSERKVIVRDMDGTLAYATLDTTKRMNQLY 169
            ::.:..:..|:|:|..|:....:|:|||||::.....||.::||:..|||..|:.:...||.|:|
Human   132 LEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVY 196

  Fly   170 FPLEGRQSYTPRMFALEELLAKCLAEHKYEFILDRLLVQYEPHEPEFHNISARVFEHLNESKEFD 234
            ||.|||:..||.:|. ||.|....::.::..:|:....|:||...|:..:..:.:|.:::..::|
Human   197 FPKEGRKILTPIIFK-EENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYD 260

  Fly   235 LLRSTRHFGPMAFFYAWHRCIDDLLYDMIRRDYLHNAVELIALSYKLHNIPVEYQATLTELGKLH 299
            ||||||:||.|.:::..::.||.||.|.|:||.:.:|..|:.|.:.||                 
Human   261 LLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLH----------------- 308

  Fly   300 ATPAESALAELRSVFRRHDNKQNIEQEIHTAIGKTEHDFAADEISLKFIEQYIASEHALKKVQLE 364
             ...:||                          :...|.||:.|:|  |:.:..:| |.|...:|
Human   309 -PDGQSA--------------------------QGAKDQAAEGINL--IKVFAKTE-AQKGAYIE 343

  Fly   365 LAVQTLKE 372
            |.:||.:|
Human   344 LTLQTYQE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS22NP_524537.1 MRP-S22 41..282 CDD:287247 82/240 (34%)
MRPS22NP_064576.1 MRP-S22 70..309 CDD:402036 83/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144497
Domainoid 1 1.000 155 1.000 Domainoid score I4240
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57030
Inparanoid 1 1.050 156 1.000 Inparanoid score I4306
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48815
OrthoDB 1 1.010 - - D363634at33208
OrthoFinder 1 1.000 - - FOG0007406
OrthoInspector 1 1.000 - - oto89053
orthoMCL 1 0.900 - - OOG6_107905
Panther 1 1.100 - - LDO PTHR13071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4394
SonicParanoid 1 1.000 - - X5531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.