DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and pnt

DIOPT Version :8

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster

Alignment Length:747 Identity:137/748 (18%)
Similarity:204/748 (27%) Gaps:387/748 (52%)


  Fly    88 TNPSSHQLIPPPAYPHSA---------------------------------YPSPQSSPLQSEFA 119
            |:.|:.:.:.|||.|.||                                 :.||.||.|.|..:
  Fly     8 TDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLNAINGHLFKSPASSHLNSVGS 72

  Fly   120 AYGLGRFGGSYDSLNSPSPSLEAVSIKQELHILPPSPPESNCETPSPRSSCGES----IKAEPLD 180
            ...|.:..|..:|.|. |..:..:.:|:...:             :..||..||    ||.||:.
  Fly    73 PSILSQLNGIGNSGNH-SGQVSTMRLKKNRKV-------------TFLSSLVESKNIFIKEEPIH 123

  Fly   181 A--DIESLIDLNSLLQQQSLQSPQNLQDTKP-DHQLLRECLEDTSFQKRHNLKPLALESFIGGLA 242
            .  |:.||.|::.  .:.||:.|..|....| .::.:.|.|:               .||.....
  Fly   124 GCKDLCSLSDISD--HEASLEVPTALPPLTPGTNRKVNEVLK---------------ASFASWEK 171

  Fly   243 EVRGDFEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLPPVADLELHF 307
            ||:                       :..|::||..|:...|..||.....:|.|..: :|:..:
  Fly   172 EVQ-----------------------KCNITKDPREWTEEHVIYWLNWAKNEFSLVSM-NLDPFY 212

  Fly   308 CENGAALALLSEEEFVRRLPE-SGSTLHAQLEIWKMAYADQPAH---QQHSQQSAST------DH 362
            ...|.|:..|.:|:|:...|. :|..|...|:|.:.. .::|..   ..:|.:||:|      ||
  Fly   213 KMKGRAMVDLGKEKFLAITPPFTGDILWEHLDILQKD-CEKPNEDIVHGNSFESATTASVCGSDH 276

  Fly   363 WPASY-----------------------------------AMPHLDLDYNEDSEDD------DDM 386
            ..|:|                                   |.||....||..:..|      ...
  Fly   277 QVANYPNETHANSNNSSINSRLSMDYVTSAGNSDNKNFHRATPHSHNGYNTSNTHDRINNSTPPQ 341

  Fly   387 EADAQVAPLNGSTTS---------PPATNASN--------------------------------- 409
            :..:|...:|||.::         |||...||                                 
  Fly   342 QQQSQQPTVNGSGSASSNNNNSMLPPAVQQSNNENNNTSSSNTNNSSNNNNNSGGSNNSNAGSNN 406

  Fly   410 -------------------------------------------------------------GGTA 413
                                                                         ||:.
  Fly   407 NNNNNNNINFMAAAAIFQHHLKEEPGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHLAAYGGGSG 471

  Fly   414 TVKRPNGGRTGGGG--------------------------------------------------- 427
            :  .|.|||:.|||                                                   
  Fly   472 S--GPTGGRSSGGGGDESDYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSY 534

  Fly   428 -------------------------------------SHIH------------------------ 431
                                                 :|.|                        
  Fly   535 AGRNRFHDGYPPEFTPYDAQSFQSMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQG 599

  Fly   432 ------------LWQFLKELLASPQ----VNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNRPA 480
                        |||||.|||....    ::.|...|      .||:.|...||:.||.|||:|.
  Fly   600 GVPCFTGSGPIQLWQFLLELLLDKTCQSFISWTGDGW------EFKLTDPDEVARRWGIRKNKPK 658

  Fly   481 MNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            |||:||||.:|.||.|.|:.|| ..:|.||:|
  Fly   659 MNYEKLSRGLRYYYDKNIIHKT-AGKRYVYRF 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 20/82 (24%)
ETS 429..517 CDD:197710 41/125 (33%)
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879 19/73 (26%)
ETS 609..693 CDD:197710 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129178833
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11849
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.