DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and Ets65A

DIOPT Version :8

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster

Alignment Length:247 Identity:71/248 (29%)
Similarity:94/248 (38%) Gaps:89/248 (36%)


  Fly   348 PAHQQH--------SQQSASTDHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPA 404
            ||..||        ...|.:.|...|:.|:|  .|..:..|..:..:.||.  :.|:.:|||..|
  Fly   157 PAVTQHGVITSSAGQVTSGTLDAVSAAPALP--SLTASSSSHVEHKVRADK--STLDCATTSSHA 217

  Fly   405 TNASNGGTAT---------VKRPNGGRTGGG-------------------GSH------------ 429
            ...|:..:|:         .|..|...||||                   |||            
  Fly   218 AAPSSSSSASDHQQGRISGSKSSNTSGTGGGASASGGGGSALYSSYKSSWGSHSSTQSQGYSSNA 282

  Fly   430 ----------------------------------IHLWQFLKELLASPQVNGTAIRWIDRSKGIF 460
                                              |.|||||.||| |...|.:.|.| :.:.|.|
  Fly   283 LGIKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELL-SDSNNASCITW-EGTNGEF 345

  Fly   461 KIEDSVRVAKLWGRRKNRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            |:.|...||:.||.||::|.||||||||::|.||.|.||.|. ..:|..|:|
  Fly   346 KLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKV-HGKRYAYKF 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878
ETS 429..517 CDD:197710 43/131 (33%)
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 42/85 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11849
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.