DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and SPIC

DIOPT Version :8

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_689536.1 Gene:SPIC / 121599 HGNCID:29549 Length:248 Species:Homo sapiens

Alignment Length:102 Identity:37/103 (36%)
Similarity:66/103 (64%) Gaps:9/103 (9%)


  Fly   414 TVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKI--EDSVRVAKLWGRRK 476
            |:.:..||:   |...:.|:::|.|.|.:|:: .:.|:|:|::||||:.  ::..::|:|||:||
Human    98 TLLQQKGGK---GRKKLRLFEYLHESLYNPEM-ASCIQWVDKTKGIFQFVSKNKEKLAELWGKRK 158

  Fly   477 -NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
             ||..|.|.|::|::|.|.:.|.:.|..|  :|.|||
Human   159 GNRKTMTYQKMARALRNYGRSGEITKIRR--KLTYQF 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878
ETS 429..517 CDD:197710 33/88 (38%)
SPICNP_689536.1 Ets 116..194 CDD:306647 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.