DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and spib

DIOPT Version :8

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_017950796.1 Gene:spib / 100271885 XenbaseID:XB-GENE-479615 Length:282 Species:Xenopus tropicalis

Alignment Length:257 Identity:62/258 (24%)
Similarity:106/258 (41%) Gaps:62/258 (24%)


  Fly   302 DLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLE--IWKMAYADQPAHQQH------SQQSA 358
            |||. |.::|.:.:..||.:     .::|:.....|.  :|.:..|:.|.::.:      |.|:.
 Frog    24 DLEA-FNKHGNSYSQTSESD-----TQTGADFGFGLADLLWSLIEAEDPGYETYDNIQLTSLQNV 82

  Fly   359 STDHWPASYAMPHLD----LDYNEDSEDDDDMEADAQVA---------PLNGSTTSPPAT----- 405
            ...:.|::|....||    ||..........:..|..:.         |:.|:..|||.:     
 Frog    83 QLPYLPSTYPQYCLDTLQALDGTVQCPAQCPLPDDLYIGEPYPPYATYPMPGNVPSPPLSEEEDF 147

  Fly   406 -----------------NASNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWI 453
                             |.|.|...       |...|....:.|::||.|||.:..:. ..|.|:
 Frog   148 RHAESPPLEVSDSDSDENFSPGECI-------GYDPGVRKKVRLYKFLLELLQNGDMR-DCIWWL 204

  Fly   454 DRSKGIFKIEDSVR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            ||.:|.|:.....:  :|..||::| ||..|.|.|::|::|.|.|.|.::|.::  :|.|||
 Frog   205 DRERGTFQFSSKHKELLAHRWGQQKGNRKKMTYQKMARALRNYGKTGEIRKVKK--KLTYQF 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 10/45 (22%)
ETS 429..517 CDD:197710 31/88 (35%)
spibXP_017950796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.