DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and spi1

DIOPT Version :8

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001139455.1 Gene:spi1 / 100125218 XenbaseID:XB-GENE-1018247 Length:266 Species:Xenopus tropicalis

Alignment Length:245 Identity:70/246 (28%)
Similarity:103/246 (42%) Gaps:58/246 (24%)


  Fly   298 PPVADLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLE------IWKMAYADQPAHQQ---H 353
            |.::|.|.|        |.|.|..:....|.    ||.:||      :.::.....|..||   |
 Frog    33 PYLSDSESH--------ASLLEHYWEYPTPH----LHGELEGFPDSQLTELQSVQPPQLQQLYRH 85

  Fly   354 SQQ-------SASTDH------WPASYAMPHLDLDY---NEDSEDDDDMEADAQVAPLNGSTTSP 402
            .::       ...|.|      ...|| ||.:.|.|   .:.|.|:::.|           ..||
 Frog    86 MEEQMHVLEPGLPTPHPHLSIGHQVSY-MPRVGLQYIATGQPSSDEEEHE-----------RRSP 138

  Fly   403 PATNASNGGTATVKRPNGGRTGGGGS--HIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDS 465
            | ...|:|...:.....|...|..||  .|.|:|||.|||.|..:. .:|.|:|:.||.|:....
 Frog   139 P-LEVSDGEMDSRDPTYGMLQGEPGSKKKIRLYQFLLELLQSGDMK-DSIWWVDKDKGTFQFSSK 201

  Fly   466 VR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            .:  :|..||.:| ||..|.|.|::|::|.|.|.|.:.|.::  :|.|||
 Frog   202 HKEVLAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVHKIKK--KLTYQF 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 12/53 (23%)
ETS 429..517 CDD:197710 34/88 (39%)
spi1NP_001139455.1 ETS 166..254 CDD:197710 34/88 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.