DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and Rps10

DIOPT Version :8

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_112371.1 Gene:Rps10 / 81773 RGDID:621024 Length:165 Species:Rattus norvegicus

Alignment Length:161 Identity:96/162 (59%)
Similarity:114/162 (70%) Gaps:7/162 (4%)


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSEL-DK-IPNLQVIKVMQSLNSRGWVKEQFAWR 63
            |.:||.||:||||.||||||:|||||..:.||.|| || :|||.|:|.||||.|||:||||||||
  Rat     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWR 65

  Fly    64 HFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFGGA-SKTDDDRSNY 127
            ||||.||||||:.||.||||||||||:|| :.:|....|||  |.||.|..... ::.:.||..|
  Rat    66 HFYWYLTNEGIQYLRDYLHLPPEIVPATL-RRSRPETGRPR--PKGPEGERPARFTRGEADRDTY 127

  Fly   128 RRGPGAYGMDKKGDVGAGTG-RVEYRGGFGR 157
            ||.....|.|||.:.|||:. ..::||||||
  Rat   128 RRSAVPPGADKKAEAGAGSATEFQFRGGFGR 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 69/95 (73%)
Rps10NP_112371.1 S10_plectin 3..97 CDD:308874 69/95 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5045
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H788
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001820
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12146
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.