DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and PLEC

DIOPT Version :8

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_005251033.1 Gene:PLEC / 5339 HGNCID:9069 Length:4689 Species:Homo sapiens

Alignment Length:141 Identity:68/142 (48%)
Similarity:85/142 (60%) Gaps:15/142 (11%)


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKD-SPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRH 64
            |.:|:....||||.||:|||:||||| .|...|..:..:.||||::.|.||.:||.|:|.|||.|
Human     5 MLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRETFAWCH 69

  Fly    65 FYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNA-VRP----------RGGPGGPGGGFGGAS 118
            |||.||||||..||:||||||||||::|.:..|..| |.|          :|..|.|..  .|..
Human    70 FYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPK--RGPL 132

  Fly   119 KTDDDRSNYRR 129
            .|::.|. |||
Human   133 PTEEQRV-YRR 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 54/94 (57%)
PLECXP_005251033.1 S10_plectin 7..101 CDD:281497 54/94 (57%)
CH 180..287 CDD:237981
CH 302..400 CDD:278723
SPEC 664..853 CDD:238103
SPEC 760..949 CDD:238103
SPEC 1244..1434 CDD:238103
Myosin_tail_1 1485..2608 CDD:279860
GBP_C <1494..1621 CDD:303769
coiled coil 1585..1596 CDD:293879
coiled coil 1605..1621 CDD:293879
ATP-synt_B <1620..1740 CDD:304375
SPEC 1868..2070 CDD:295325
GBP_C <2380..2507 CDD:303769
coiled coil 2474..2487 CDD:293879
coiled coil 2496..2507 CDD:293879
Plectin 2833..2873 CDD:279071
Plectin 2871..2911 CDD:279071
PLEC 2908..2944 CDD:197605
Plectin 2946..2987 CDD:279071
Plectin 3162..3201 CDD:279071
Plectin 3199..3239 CDD:279071
PLEC 3236..3272 CDD:197605
Plectin 3274..3314 CDD:279071
PLEC 3492..3526 CDD:197605
Plectin 3536..3570 CDD:279071
PLEC 3567..3598 CDD:197605
Plectin 3605..3646 CDD:279071
Plectin 3827..3867 CDD:279071
Plectin 3865..3905 CDD:279071
PLEC 3902..3938 CDD:197605
Plectin 3940..3981 CDD:279071
Plectin 4069..4110 CDD:279071
Plectin 4108..4148 CDD:279071
Plectin 4183..4224 CDD:279071
Plectin <4285..4315 CDD:279071
PLEC 4417..4450 CDD:197605
Plectin 4452..4491 CDD:279071
Plectin 4528..4569 CDD:279071
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.