DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and MCD4

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_012756.1 Gene:MCD4 / 853690 SGDID:S000001648 Length:919 Species:Saccharomyces cerevisiae

Alignment Length:992 Identity:246/993 (25%)
Similarity:429/993 (43%) Gaps:185/993 (19%)


  Fly     1 MWK-----LQALVV--HILLMGAILNTYFQHTLLPNLVPQKTMRELGLEPPADRLVVFVTDGLRA 58
            ||.     |.|:.|  |:..:.:|.:.||...|:..:.|.::..    .|||.||.:.|.|||||
Yeast     1 MWNKTRTTLLAVGVLFHLFYLWSIFDIYFISPLVHGMSPYQSTP----TPPAKRLFLIVGDGLRA 61

  Fly    59 AT--------------FLANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAGFHEDPA 109
            .|              |||      |.::.:.......|||.|..||.:||||:|:.|||:||.:
Yeast    62 DTTFDKVTHPVSGKTEFLA------PFIRSLVMNNATYGISHTRMPTESRPGHVAMIAGFYEDVS 120

  Fly   110 ASLMHLCYNPGDFDTVFNRSRNMIGWAHSYIVGY--FVKLSHGGA--PLRFDSYM-----ERDLP 165
            |.......||.:||:.||:|      .|:|..|.  .:.:...||  |.:.|::|     |....
Yeast   121 AVTKGWKSNPVNFDSFFNQS------THTYSFGSPDILPMFKDGASDPNKVDTWMYDHTFEDFTQ 179

  Fly   166 EKLTCDKWAFDKVENFLRN------VD-NVREWRNYKPAVFFVYLADMDIAAHRFKPLSKKFFAK 223
            ..:..|.:.|..::....|      :| .:|:..|    |||::|...|.|.|.::|.|.:::..
Yeast   180 SSIELDAFVFRHLDQLFHNSTLNSTLDYEIRQDGN----VFFLHLLGCDTAGHSYRPYSAEYYDN 240

  Fly   224 LQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFMWGAGVKR---D 285
            ::|....|....:...:.|.|.:||::.|:||||:..|:||.|.|....|||..||||:.:   :
Yeast   241 VKYIDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHN 305

  Fly   286 EIDAEANFPEKPNIS-----QVDQTQLAPLMSSLIGLPPPKNNLALMPVGYLNVSDEYQAVALHL 345
            ......|:.|...:|     .|.|..:|.|||.|||:..|||::..:|:.|::..:..:..||:.
Yeast   306 PFPVSDNYTENWELSSIKRNDVKQADIASLMSYLIGVNYPKNSVGELPIAYIDGKESDKLAALYN 370

  Fly   346 NVLQLLSQAEILIGRHE---KAIFYKWLPKFKE-LHIGVIDQYAAQFDIL---KSEGN---LTDA 400
            |...:|.|  .|:.:.|   ...|||...||.| .|    ..|..:.:.|   .|||.   ..:|
Yeast   371 NARSILEQ--YLVKQDEVIDSQFFYKEYFKFVEKSH----SHYLEEIETLIQRISEGENYLEQEA 429

  Fly   401 MEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSYMIW-FYCLLLQLTRLSKKEKMQRRGFMTVST 464
            :...:|..::..:.|.|...|....:....:..::.| |:..::.|.....:..:..:....:|.
Yeast   430 ITLTEELMQITLEGLHYLTTYNWRFIRTIVTFGFVGWIFFSFIIFLKSFILENVIDDQKASPLSH 494

  Fly   465 LILAMIGILLIAMMELQKVPHIAAFYLILPVGMLIMAQAERPVRGYWIFHPLWNFGF----ILVP 525
            .:...|||||..::..|..|.....||:.|:              |:     |::.|    :|..
Yeast   495 AVFGSIGILLNWILFYQHSPFNFYMYLLFPL--------------YF-----WSYIFTNRSVLRS 540

  Fly   526 AV------------LIMSMTFIIRHLWVLYGI-----SVLLNNRRA-------LRKPSIKLFIWL 566
            .:            ::::::.|..:..::||.     ..|:.|..|       :|:.|:.: :| 
Yeast   541 GIKEFFKGTSPWKRVLITISIISVYEGIVYGFFHRWTFTLITNILAFYPFICGVRELSVNI-LW- 603

  Fly   567 SLALIVTAILFMEQRTIKGLKTIPVKDYHVLYVSMVLAIIRPLILGHRHDPRVWTFNSLTLVVGA 631
                |:|::|.   .|......:.::|.:.::::.:|.|:......::...|:   ||.|..:.|
Yeast   604 ----IITSVLL---STFTLFDAVKIEDLNQIHLAGLLIILSAFYALYKIHSRI---NSYTRAIFA 658

  Fly   632 F--------------GVYQYKFYESVSSYVYVVTWSFLFFAF--LSIVYFAKSLPEARKRLELIT 680
            .              .|...:..:.:.....|..|...|.:.  :.|:::.|...:.:.||.:|.
Yeast   659 IQISLVAAMLAVTHRSVISLQLRQGLPRESQVAGWIIFFVSLFVMPILHYRKPNNDYKVRLLIIY 723

  Fly   681 INMITVLSLLTNSWGCLNFQIAITEFIFGLQIYEETKETKEIEDAKDEHTSLQNLK----GFYRY 741
            :.......:||.|:..| |....|.::  :|..|...:.||::..|||:. ||.|:    ||:  
Yeast   724 LTFAPSFIILTISFESL-FYFLFTSYM--VQWIEIENKIKEMKTQKDENW-LQVLRVSVIGFF-- 782

  Fly   742 GYMILLYFYVSFFLAGH--WISSFLFKPTTARLFYPHFSLYIAGSLVLLKIFIP-SVIFIC--AL 801
                  ...|:||..|:  .||||..: :..||. |.|..::.|:|::||:.|| .::..|  .|
Yeast   783 ------LLQVAFFGTGNVASISSFSLE-SVCRLL-PIFDPFLMGALLMLKLIIPYGLLSTCLGIL 839

  Fly   802 YAMVPFVRKNARSILISIFMISNAMGLYQYYFIRNRGSWRKIRMFLDQILLTHAVN-FMLLLGIS 865
            ...:.|......|::||   :|:.:.|..:|.:|..|||..|.:.:....|....: |||:|.: 
Yeast   840 NLKLNFKDYTISSLIIS---MSDILSLNFFYLLRTEGSWLDIGITISNYCLAILSSLFMLILEV- 900

  Fly   866 LAKIFLANTTMERPGQK 882
            |..:.|.|..::...:|
Yeast   901 LGHVLLKNVIIQDKTKK 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 102/324 (31%)
PigN 414..839 CDD:282796 98/479 (20%)
MCD4NP_012756.1 Npp1 14..615 CDD:224441 166/655 (25%)
GPI_EPT_1 46..353 CDD:293744 102/323 (32%)
PigN 443..874 CDD:282796 98/479 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325495099
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1579
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002473
OrthoInspector 1 1.000 T634437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12250
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.