DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and LAS21

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_012473.1 Gene:LAS21 / 853384 SGDID:S000003598 Length:830 Species:Saccharomyces cerevisiae

Alignment Length:923 Identity:191/924 (21%)
Similarity:317/924 (34%) Gaps:294/924 (32%)


  Fly    37 RELGLEPPADRLVVFVTDGLRAATFLANNGSDVPDLKDIYR--QQGRIG--ISRTCAPTMTRPGH 97
            |:|..:.|..:||..:.|.|| :.||.:  |.:....::::  ..|...  .|....||:|.|..
Yeast    43 RDLQRDRPFQKLVFVIIDALR-SDFLFD--SQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRL 104

  Fly    98 IAIFAGFHEDPAASLMHLCYNPG-DFDT-----------VFNRSRNMI--------------GW- 135
            .:|..|    ...|.:.|..|.. |.|:           .|.:..|.|              .| 
Yeast   105 KSITTG----STPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWF 165

  Fly   136 -----AHSYIVGYFVKLSHGGAPLRFDSYMERDLPEKLTCDKWAFDKVENFLRNVDNVREWRNYK 195
                 .||:.|..|.::         |:.:.|:||.||                   .:||..:.
Yeast   166 DFADPTHSFFVSDFTQV---------DNNVTRNLPGKL-------------------FQEWAQWD 202

  Fly   196 PAVFFVYLADMDIAAHRFKPLSKKFFAKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNE 260
            .|:.. ||. :|...|:..|.||...||.|.....:::.|:......:|..|...:..|||||..
Yeast   203 VAILH-YLG-LDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNEL 265

  Fly   261 GAHGSGSPLEVETPLFMWG---AGVKRDEIDAEANFP--EKPN-----ISQVDQTQLAPLMSSLI 315
            |.||..|..|....|....   |...|.|.......|  ..|:     :..|.|..:.|.:::|.
Yeast   266 GNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALF 330

  Fly   316 GLPPPKNNLALMPVGYLNVSDEYQAVALHLNVLQLLSQAEILIGRHEKAIFYKWLPKFKELHIGV 380
            |:|.|.|::.::      :.|          .||||...   :...::...:.|  |..:.|..|
Yeast   331 GMPIPMNSVGII------IPD----------FLQLLPNK---LASMKENFMHLW--KLSDHHGEV 374

  Fly   381 -IDQYAAQFDILKSEGNLTDAMEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSYMIWFYCLLLQ 444
             :|.:.|: ||            :.|.|  ..::.||.....|..||:....:.::|.....:..
Yeast   375 ALDDFTAE-DI------------YTKMY--TIQETLTKSATNYNYPLLTLAFVGFLIITIIAIYV 424

  Fly   445 LTRLSKKEKMQRRGFMTVSTLILAMIGILL------IAMME------------LQKVP-HIAAFY 490
            |.|.|..:..|.|    ||:|.:.::.|:|      .:.:|            ...|| .:....
Yeast   425 LLRYSGPDFWQLR----VSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVPLFVYRLN 485

  Fly   491 LILPVGMLIMAQAERPVRGYW-------IF----------HPLWNFGF-ILVPAVLIMS------ 531
            :::.|...||....|.:: :|       |:          :|.|.:.. :|...||||:      
Yeast   486 VLIIVRWFIMMACVRSIK-FWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLTFLVLIMASAGFQV 549

  Fly   532 ----MTFIIRHLWVLYGIS-VLLNNRRALRKPSIKLFIWLSLA----------LIVTAILFMEQR 581
                :|.|:..|...|.|| .::|..:|    .|.||:...||          |||.|.:|.:..
Yeast   550 LHFIVTTILVGLCFTYKISWEIVNGNQA----EIPLFMHDLLAKIDFAPTESNLIVLARVFFQAW 610

  Fly   582 TIKGL------------KTIPVKDYHVLYVSMVLAIIRPLILGHRHDPRVWTFNSLTLVVGAFGV 634
            .|..:            |...:||..| |::::|                 .|.:.:..:|.|.|
Yeast   611 AIVVISRLVLTKLKVLNKNYLIKDMKV-YITILL-----------------MFQTSSQNIGQFLV 657

  Fly   635 YQ------YKFYESV-------------SSYVYVVTWSFLFFAF----------LSIVYFAKSLP 670
            :|      :.|::::             |:.|.::..:|.||.|          |...|...|..
Yeast   658 FQILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSISTIDLGNAYHGVSSD 722

  Fly   671 EARKRLELITINMITVLSLLTN-----SWGCLNFQI--AITEFIFGLQIYEETKETKEIEDAKDE 728
                    ..|.::.:|..:.|     .|..|.:.|  |.......||.:..:|           
Yeast   723 --------YNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIRSK----------- 768

  Fly   729 HTSLQNLKGF-YR--YGYMILLYFYVSFFLAGHWISSFLFKPTTARLFYPHFSLYIAGSLV--LL 788
                  |..| |.  :|..::....|..|....|           .:|.|....::..:.|  ||
Yeast   769 ------LPAFTYHCIFGTCLMTACVVLRFHLFIW-----------SVFSPKLCYFLGWNFVMGLL 816

  Fly   789 KIFIPSVIFICAL 801
            ..::|.:..:|||
Yeast   817 NGWLPELALLCAL 829

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 76/332 (23%)
PigN 414..839 CDD:282796 98/500 (20%)
LAS21NP_012473.1 Npp1 18..610 CDD:224441 143/649 (22%)
GPI_EPT_2 48..343 CDD:293748 76/338 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.