DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and GPI13

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_013069.1 Gene:GPI13 / 850628 SGDID:S000003954 Length:1017 Species:Saccharomyces cerevisiae

Alignment Length:989 Identity:171/990 (17%)
Similarity:324/990 (33%) Gaps:353/990 (36%)


  Fly     4 LQALVVHILLMGAILNTYFQHTLLPNLVPQKTMRELGLEPPA-DRLVVFVTDGLR---------- 57
            ||.:.:.....|.:|:.:    :|.|:..|....:|   ||. ::.|:.|.|.||          
Yeast    45 LQFISIAFFTRGFLLSRH----VLDNISSQNETSKL---PPRFNKAVILVIDALRFDFAIPVNES 102

  Fly    58 AATFLANNGSDVPDLKDIYRQ--------------------QGRIGISRTCAPTMTRPGHIAIFA 102
            .:.:..|..:::..|.|.:..                    |...|::....||....|  :.|.
Yeast   103 HSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAG--SNFD 165

  Fly   103 G--FHEDPAASLMHLCYNPGDFDTVFNRSRNMIG---WA---HSYIVGYFVKLSHGGAPLRFDSY 159
            |  ..||.....:||.          |::....|   |.   |.:       ||:...||.    
Yeast   166 GTVIEEDNFLKQLHLA----------NKTVKFAGDDTWMALFHPF-------LSNDSFPLE---- 209

  Fly   160 MERDLPEKLTCDKWAFDKVEN-----FLRNVDNVREWRNYKPAVFFVYLADMDIAAHRFKP---- 215
                     :.:.|..|.|:|     |..::...:||     .|...::..:|...|::.|    
Yeast   210 ---------SLNVWDLDTVDNGVMDYFHDHLQQDKEW-----DVMIGHMLGIDHVGHKYGPDHFT 260

  Fly   216 LSKKFFAKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFMWGA 280
            :.:|.....|:....:::.         |..|..::..||||::.|.||..|..|:|:.||::..
Yeast   261 MREKQIQVDQFIDWILKSI---------DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSK 316

  Fly   281 GVKRDEIDAEANFPEKPNIS-------QVDQTQLAPLMSSLIGLPPPKNNLALMPVGYLNVSDE- 337
            ......:...:|:    ||.       .|.|..|...::.|:|.|.|.|||. .|:..:..:|. 
Yeast   317 KPDMWRLKETSNY----NIDNLGHDYRSVRQIDLVSSLALLMGQPIPFNNLG-WPIDEIARNDRE 376

  Fly   338 -YQAVALHLNVLQLLSQA-EILIGRHE------KAI-----------FYKWLPKFKELHIGVIDQ 383
             .|.|...::.|||.... :|..|..|      |.|           |.|...|::::.:...::
Yeast   377 WSQFVNSAISQLQLYKDTMQIHHGNDEILEPLAKNISNTPPTSDPEKFVKLGHKYQKVFLQTCEE 441

  Fly   384 YAAQFDILKSEGNLTDAMEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSYMIWFYCLLLQLTRL 448
            ..|:||                           ||:        :|..::.:.....||:.:|:|
Yeast   442 LWAKFD---------------------------YYS--------IATGITLLATSLVLLISITKL 471

  Fly   449 SKKEKMQRRGFMTVSTLILAMIGILLIAMMELQKVPHIAAFYLILPV---GMLIMAQAERPVRGY 510
                                 |..:::..|..:.||.|....|:..:   |:..:.|....|..:
Yeast   472 ---------------------IPSIVVNQMVPEFVPGIIIMVLVTNLCFHGIFYVYQQPSFVDQF 515

  Fly   511 WIFHPLWNFGFILVPAVLIMSMTFIIRHLWVLYGISVLLNNRRALRKPSIKLFIWLSLALIVTAI 575
            |        |.:|..|:            .::.|..:.:.:|..        |||:::.|..|  
Yeast   516 W--------GTLLATAI------------GIIIGCYITIFDRYN--------FIWIAMRLGET-- 550

  Fly   576 LFMEQRTIKGLKTIPVKDYHVLYVSMVLAIIRPLILGHRHDPRVWTFNSLTL--------VVGAF 632
                           :.||. ..::::..||..|:         :|.||.|:        ::..|
Yeast   551 ---------------LADYW-SRIAVMFMIIHALL---------FTSNSFTIWEDRIVAFLLSTF 590

  Fly   633 G---VYQYKFYESVSSYVYVVTW--------------SFLFFAFLSIVYFAKSLPEARKRLELIT 680
            |   :|::.|.....|...::|.              |.....:|.:..||:.|......:.:|.
Yeast   591 GMLTLYEFVFLPKRQSTTALLTATISEKEGTTSGVNPSTANSNYLPLTRFARLLGGYHSAVLIIF 655

  Fly   681 INMITVLSLLTNSWGCLNFQIAITEFIFGLQIYEETKETKEIEDAKDEHTSLQNLKGFYRYGYMI 745
            ..:.:::::.....|    :..|..|                        :.||...::..|...
Yeast   656 TRLASMITICREEQG----EYCIPTF------------------------NNQNNSSWWVLGLCF 692

  Fly   746 LLYFYVSFFLAGHWISSFLFKPTTARLFYPHFSLYIAGSLVLLKIFIPSVIFICALY-------- 802
            |:.|.:...:.|               :|...|.|.|.:.:.:.:|:..::.:..:|        
Yeast   693 LMIFILPACITG---------------YYNLTSSYQAAAPIWINVFLKGILGLNFVYWSLTSLEN 742

  Fly   803 ----AMVPFVRKNARSILISIFMISNAMGLYQYYFIRNRGSWRKIRMFLDQILLTHAVNFMLLLG 863
                ..:||:|.      ::||..:.|..:..:..|.:...|                    |:|
Yeast   743 NSAVIAIPFLRD------VTIFKFTLARIIAGFSLIASNVGW--------------------LMG 781

  Fly   864 ISLAKIFLANTTME 877
            ....|:.:.||.::
Yeast   782 PLCIKLNIHNTDVK 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 69/341 (20%)
PigN 414..839 CDD:282796 70/465 (15%)
GPI13NP_013069.1 Npp1 48..701 CDD:224441 149/850 (18%)
GPI_EPT_3 77..367 CDD:293747 70/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.