DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and ENPP5

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001277001.1 Gene:ENPP5 / 59084 HGNCID:13717 Length:477 Species:Homo sapiens

Alignment Length:607 Identity:118/608 (19%)
Similarity:194/608 (32%) Gaps:231/608 (38%)


  Fly     7 LVVHILLMGAILNTYFQHTLLPNLVPQKTMRELGLEPPADRLVVFVTDGLR------AAT----F 61
            |:|..:|....|:|.|                 .|:|...::::...||.|      ..|    :
Human     6 LLVSFILAALSLSTTF-----------------SLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHY 53

  Fly    62 LANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAG-FHE----------DP----AAS 111
            :...|..|..:.:::             .|.|.|.|..:..| |.|          ||    :.|
Human    54 IMKYGVHVKQVTNVF-------------ITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFS 105

  Fly   112 LMHLCYNPGDFDTVFNRSRNMIGWAHSYIVGYF----------VKLSHGGAPLRFDSYMERDLPE 166
            |.|:    ..:|:.|......| |..:...|:.          ||: |...|..:..|.|.    
Human   106 LDHM----NIYDSKFWEEATPI-WITNQRAGHTSGAAMWPGTDVKI-HKRFPTHYMPYNES---- 160

  Fly   167 KLTCDKWAFDKVENFLRNVDNVREWRNYKPAV--FFVYLADMDIAAHRFKP-----------LSK 218
                        .:|...|..:.||...|..:  ..:|..|.|...|...|           :.|
Human   161 ------------VSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDK 213

  Fly   219 KFFAKLQYTQRG-IRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFMWGAGV 282
            |....:|..::. :.||..|            ::||||||....          |..|.      
Human   214 KLGYLIQMLKKAKLWNTLNL------------IITSDHGMTQCS----------EERLI------ 250

  Fly   283 KRDEIDAEANFPEKPNISQVDQTQLAPLMSSLIGLPPPKNNLALMPVGYLNVSDEYQAVA-LHLN 346
               |:|   .:.:|.:.:.:||:.:|.::        ||..         ...:.|:|:. .|.|
Human   251 ---ELD---QYLDKDHYTLIDQSPVAAIL--------PKEG---------KFDEVYEALTHAHPN 292

  Fly   347 VLQLLSQAEILIGRHEKAIFYKWLPKFKELHIGVIDQYAAQFDILKSE------GN--------- 396
             |.:..:.::....|     ||:..:.:.: |.|.|:   .:.||:::      ||         
Human   293 -LTVYKKEDVPERWH-----YKYNSRIQPI-IAVADE---GWHILQNKSDDFLLGNHGYDNALAD 347

  Fly   397 -----LTDAMEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSYMIWFYCLLLQLTRLSKKEKMQR 456
                 |.....|.|.:.|.|......|      ||:            |.||.:|      .|..
Human   348 MHPIFLAHGPAFRKNFSKEAMNSTDLY------PLL------------CHLLNIT------AMPH 388

  Fly   457 RG-FMTVSTLILAMIGILLIAMMELQKVPHIAAFYLILPVGMLIMAQAERPVRG---YWIFHPLW 517
            .| |..|..|:.:       ||..:  ||:..: .::||..   :..||....|   |:|     
Human   389 NGSFWNVQDLLNS-------AMPRV--VPYTQS-TILLPGS---VKPAEYDQEGSYPYFI----- 435

  Fly   518 NFGFILVPAVLIMSMTFIIRHL 539
              |..|...::|:.....|:||
Human   436 --GVSLGSIIVIVFFVIFIKHL 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 62/335 (19%)
PigN 414..839 CDD:282796 29/131 (22%)
ENPP5NP_001277001.1 Phosphodiest 30..342 CDD:307681 76/408 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.