DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and Pigo

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_064419.2 Gene:Pigo / 56703 MGIID:1861452 Length:1101 Species:Mus musculus

Alignment Length:1065 Identity:213/1066 (20%)
Similarity:344/1066 (32%) Gaps:365/1066 (34%)


  Fly    47 RLVVFVTDGLR-----------------AATFLANNGSDVPDLKDIYRQQGRIGISRTCAPTMTR 94
            |:|:.:.|.||                 :..||...||    |:.|...|               
Mouse    77 RVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGS----LQRILESQ--------------- 122

  Fly    95 PGHIAIFAGFHEDPAASLMHL-CYNPGDFDTVFNRSRNMIGWAHSYIVGYFV-KLSHGGAPLRFD 157
            |.|..::....:.|..::..| ....|...|..:...|..  :|:.:....: :|:..|..:.| 
Mouse   123 PHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFA--SHAIVEDNVIQQLNSAGRRVVF- 184

  Fly   158 SYMERDLPEKLTCDKW------AFDKVENF-------LRNVDN-VRE----------WRNYKPAV 198
                      :..|.|      ||.:...|       |..||| :.|          |     .|
Mouse   185 ----------MGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHLYPTLDGGSW-----DV 234

  Fly   199 FFVYLADMDIAAHRFKPLSKKFFAKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAH 263
            ...:...:|...|:..|...:...||....:.|:.   |.||:.||  |..::..||||...|.|
Mouse   235 LIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQG---LIERLEND--TLLVVAGDHGMTMNGDH 294

  Fly   264 GSGSPLEVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQLAPLMSSLIGLPPPKNNLA-LM 327
            |..|.|||...||::........:.     ||:|.:  :.|..|.|.::.|:|||.|..|.. :|
Mouse   295 GGDSELEVSAALFLYSPTALFPSVP-----PEEPEV--IPQVSLVPTLALLLGLPIPFGNTGEVM 352

  Fly   328 PVGYLNVSDE--------YQAVALHLNVLQLLSQAEILIGRHEKAIFYKWLPKFKELHIGVIDQY 384
            ...:...||.        .|..|||:|..|:   :..|   |..:...:.| :.||||       
Mouse   353 AELFSGGSDSSHPHSSALAQVSALHINAQQV---SRFL---HTYSAATQDL-QVKELH------- 403

  Fly   385 AAQFDILKSEGN------LTDAMEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSYMIW------ 437
              :...|.|:.:      |.|..|        |:..|:.....:|..|..|.::....|      
Mouse   404 --RLQTLFSKASARYQHFLRDPQE--------AEAALSTLTAEFQQFLRGARALCIESWARFSLV 458

  Fly   438 -------------FYCLLLQLTRLSKKEKMQRRGFM-------------------------TVST 464
                         ..|||.....::.       ||:                         |.|.
Mouse   459 RMAGGAALLAAACLLCLLASQLAVAP-------GFLFRPLLLIPVAWGLTWTILYAGVSVTTGSK 516

  Fly   465 LILAMIGILLIA-------------------MMELQKVPHIAAFYLILPVG-----MLIMAQAER 505
            :.|.::|.:..|                   :..|..||......|::.:.     ..::|:|..
Mouse   517 IDLVVLGAVAAAGSLLPFLWKAWVSRGSKRPLAPLLPVPRPVLILLLIRLATFFSDSFVVAEARA 581

  Fly   506 P--VRGYWIFHPL----WNFGFILVPAVLIMSM------TFIIRH-----LWVLYGISVLLNNRR 553
            .  :.|..:|..:    |. |.:|.|..|.||.      |...||     ||:  ||.:||..|.
Mouse   582 TPFLLGSLVFFLVAQLHWE-GQLLPPKPLTMSRLGSSAPTAPPRHSGAHALWL--GIGLLLFTRL 643

  Fly   554 A-------LRKPSIKLFIWLS-LALIVTAILFMEQRTIKGLKTIPVKDYHVLYVSMVLAIIRPLI 610
            |       ...|:.:...||| ||.:|..                 :..::.|.:.|.|::..|:
Mouse   644 AGLFHRCPEETPACRSSPWLSPLASMVGG-----------------RAKNLWYGACVGALVALLV 691

  Fly   611 LGHRHDPRVWTFNSLTLVVGAFGVYQYKFYESVSSYVYVVTWSFLFFAFLSIVYF--AKSLPEAR 673
            :     .|:|             :.:|...:|....|..|.|........:..|:  |....||.
Mouse   692 V-----VRLW-------------LRRYGNLKSPEPPVLFVRWGMPLMVLGTAAYWALASGAEEAP 738

  Fly   674 KRLE-----------------------LITINMITVL-----------SLLTNSWGCLNFQIAIT 704
            .||.                       |:....:|||           ::||...|....| |..
Mouse   739 PRLRALVAGASAVLPRAVMGLAALGLVLLLWRPVTVLVKAGAATSRTRTILTPFSGPPTSQ-ADL 802

  Fly   705 EFIFGLQIYEETKETKEIEDAKDEHTSLQNLKGFYRYGYMILLYFYVSFFLAGHWISSFLFKPTT 769
            :::.. |||...:|..:   .:.|.|..|        |.:.:..:.:....:...:::.|.    
Mouse   803 DYVVP-QIYRHMQEEFQ---GRLERTKAQ--------GPITVAAYQLGSVYSAAMVTALLL---- 851

  Fly   770 ARLFYPHFSLYIAG-SLVLLKIFIPSVIFICALYAMVPFVRKNARSIL---ISIFMISNAMGLYQ 830
              |.:|...|::.. |||.|.:|:.|.:.:..|.|..|.......::|   :|.:::......|.
Mouse   852 --LAFPLMLLHVERVSLVFLLLFLQSFLLLHLLAAGTPVATPGPFTVLWQAVSAWVLLATQTFYS 914

  Fly   831 ----------------YYFIRNRGS--WRKIRMFLDQILL---THAVNFMLLLGISLAKI--FLA 872
                            ..|....||  |      |..:|:   |.|.:.:..:|..|..:  ||.
Mouse   915 TGHQPVFSAIHWHAAFVGFPDGHGSSTW------LPALLVGANTFASHLLFAVGCPLLLLWPFLC 973

  Fly   873 NTTMERPGQKRARTTRSNLAAAETE 897
                ||.|.||    |..|..:|:|
Mouse   974 ----ERQGPKR----RQPLPGSESE 990

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 73/325 (22%)
PigN 414..839 CDD:282796 100/574 (17%)
PigoNP_064419.2 Npp1 50..441 CDD:224441 96/437 (22%)
GPI_EPT_3 72..352 CDD:293747 72/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.