DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and pign

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001297009.1 Gene:pign / 556797 ZFINID:ZDB-GENE-080204-114 Length:932 Species:Danio rerio

Alignment Length:957 Identity:249/958 (26%)
Similarity:448/958 (47%) Gaps:155/958 (16%)


  Fly     7 LVVHILLMGAILNTYFQHTLLPNLVPQKTMRELGLEPPADRLVVFVTDGLRAATFLA---NNGSD 68
            |:||::....|.:.||...|:..:.||:    :.|.|||.|||:||.|||||.:...   :..|.
Zfish    11 LIVHVVFFLCIFDIYFTSPLVHGMTPQR----VSLPPPAKRLVLFVADGLRADSLFKPDDSGTSR 71

  Fly    69 VPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAGFHEDPAASLMHLCYNPGDFDTVFNRSRNMI 133
            .|.|:.:..:.|..|:|.|..||.:||||:|:.|||:||.:|.......||.:||:|||.||...
Zfish    72 APYLRSVIEEGGTWGVSHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSVFNESRYTW 136

  Fly   134 GWAHSYIVGYFVK-------LSHGGAPLRFDSYMERDLPEKLTCDKWAFDKVENFL---RNVDNV 188
            .|....|:..|.|       .:|...|.|.| :...|...   .|.|.||:|::||   ::.:.:
Zfish   137 CWGSPDILPMFAKGATGDHVYTHTYPPERED-FASTDASR---LDTWVFDEVKDFLTAAKSNETL 197

  Fly   189 REWRNYKPAVFFVYLADMDIAAHRFKPLSKKFFAKLQYTQRGIRNTYELFERVF-NDSRTAYLMT 252
            .:..:.:..|||::|..:|...|..:|:||:....:.....|:.:...:.:..: :|.:|||:.|
Zfish   198 LKKLHEEQNVFFLHLLGIDTNGHAHRPMSKECLENIGLVDAGVADIVTVMDDFYGHDGKTAYVFT 262

  Fly   253 SDHGMNNEGAHGSGSPLEVETPLFMWGAGVKRDEIDA----EANFPEKPNIS-----QVDQTQLA 308
            |||||.|.|:||:|.|.|..|||.:|||||::.:.:.    |.|:.::..:.     .|:|..:|
Zfish   263 SDHGMTNWGSHGAGHPSETLTPLVVWGAGVQKAQWETSQKYEDNYLKEWGLESYRRVDVNQADIA 327

  Fly   309 PLMSSLIGLPPPKNNLALMPVGYLNVSDEYQAVALHLNVLQLLSQAEILIGRHEKA----IFYKW 369
            ||||||||:|.|.|::.::|:.|||.|..::|.:::.|.:|:|.|..:.:.:.::.    :|..:
Zfish   328 PLMSSLIGIPFPLNSVGVLPLSYLNNSQHFKAESMYANAIQILEQFRVKLAQKKETTISFLFTPY 392

  Fly   370 LPKFKELHIGVIDQYAAQFDILKSEGNLTDAMEFCKEYGKLAKKCLTYYNQYYQTPLIVANSMSY 434
            .|......:..|.|..   |::: :|...:|:.:||:....|.:.|:||:.|.:..|..:..:.:
Zfish   393 QPLTDSKQVDFIRQAR---DLIQ-KGRFDEAIVYCKDLIAQAMEGLSYYHTYDRLFLGSSVVLGF 453

  Fly   435 MIW--FYCLLLQLTRLSKK----------EKMQRRGFMTVSTLILAMIGILLIAMMELQKVPHIA 487
            :.|  :..|.:..|..|.:          |::...||:.|        |:|:...:.:|..|...
Zfish   454 IGWTSYVVLYILKTHASLRKPPTNTSMVTERLLGWGFLCV--------GLLMALFLLVQSSPWSY 510

  Fly   488 AFYLILPVGM-------------LIMAQAERPVR---GYWIFHPLWNFGF-ILVPAVL---IMSM 532
            ..|.::||.:             |:.:....|:.   ||::   |..||. :||.:..   ::|:
Zfish   511 YIYSLMPVAVWYAVLKEFKTLVGLVRSIPSLPLTKCFGYFV---LVAFGIELLVMSFFYRAMLSL 572

  Fly   533 TFIIRHLW-VLYGISVLLNNRRALRKPSIKLFIW----LSLALIVTAILFMEQRTIKGLKTIPV- 591
            ..::..|| |:.|.         ..|...|...|    ||||:               ...:|| 
Zfish   573 GLVVLALWPVVSGF---------YTKAKFKSLSWTLSCLSLAV---------------FPLLPVV 613

  Fly   592 -KDYHVLYVSMVLAII--------------RPLILGHRHDPRVWTFNSLTLVVGAFGV------Y 635
             ::.::.||.....:|              .||:   |.|.:::.|..:.:.:.|:.:      .
Zfish   614 GREPNINYVISAGGLILFNSSSFLWSSWRDSPLM---RRDRQLFIFQMVQVALCAYTLTSTHSSL 675

  Fly   636 QYKFYESVSSYVYVVTWSFLFFAFLSIVYFAKSLPEARKRLELITINMITVLSLLTN-------- 692
            |.|  :.:..:..:|:||.|..:||..:..:..|   ..||..|.:::..|..||:.        
Zfish   676 QLK--QGLPIFNQLVSWSTLVSSFLIPLLSSTRL---FHRLLSILMSLTCVYLLLSTGHEALFPL 735

  Fly   693 --SWGCLNFQIAITEFIFGLQIYEETKETKEIEDAKD-EHTSLQNLK-GFYRYGYMILLYFYVSF 753
              ||..|.: |.|.:.....|......|...|:.|:: :.|.::.|: ...|..|..:.:..::|
Zfish   736 MLSWLMLAW-IHIEQEAMSRQGSSNRNELSCIDFAENIDITKVRQLRLDDIRKSYFFVFFIIIAF 799

  Fly   754 FLAGHWISSFLFKPTTARLFYPHFSLYIAGSLVLLKIFIPSVIFICALYAMVPFVRKNARSILIS 818
            |..|:..|...|.|.:...|...|:.:|.|.|::.|:.||.||.:|...::....:.::||:.:.
Zfish   800 FGCGNIASINSFDPASVYCFLTVFNPFIMGGLLMWKVLIPFVIVMCTFESIQVSTQLSSRSLFLI 864

  Fly   819 IFMISNAMGLYQYYFIRNRGSWRKIRMFLDQILLTHAVN-FMLLLGI 864
            :.:||:.|.|:.::.:::.|||..|...:...::..::. |::||.:
Zfish   865 VLVISDLMALHFFFLVKDYGSWLDIGTSISHYVIVMSMTIFLMLLSV 911

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 109/309 (35%)
PigN 414..839 CDD:282796 104/496 (21%)
pignNP_001297009.1 Npp1 11..>282 CDD:224441 95/279 (34%)
GPI_EPT_1 42..347 CDD:293744 109/309 (35%)
PigN 433..885 CDD:282796 104/496 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325479707
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141925at33208
OrthoFinder 1 1.000 FOG0002473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12250
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.