DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and T03G6.3

DIOPT Version :8

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_508470.1 Gene:T03G6.3 / 180561 WormBaseID:WBGene00020195 Length:465 Species:Caenorhabditis elegans

Alignment Length:315 Identity:61/315 - (19%)
Similarity:106/315 - (33%) Gaps:107/315 - (33%)


  Fly    11 ILLMGAILNTYFQHTLLPNLVPQKTMRELGLEPPADRLVVFVTDGLRA---------ATF----L 62
            ::|:|.:|.:                  ...:|....|:|.:.||..|         |||    |
 Worm     5 LILLGLVLGS------------------AARDPIGQNLIVILADGYGATLLNNTKPDATFGIRHL 51

  Fly    63 ANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAGFHEDPAASLMHLCYNPG-DFDTVF 126
            |.||..|..:...:             ||.|.|..:::..|.:.:          |.| ..|.::
 Worm    52 ATNGVQVDYVTPSF-------------PTHTWPQWMSLSTGLYTE----------NHGFTADYMW 93

  Fly   127 NRSRNM-------------IGWAHS-----YIVG--------YFVKLSHGGAPLRFDSYMERDLP 165
            :|..|.             :.|..:     |..|        |:....|...   :|..::  :|
 Worm    94 DRKTNFTFERGTGPNDTEDVWWDDAKAPLWYTAGKAGVDVHCYWFAHCHRAF---YDMVVQ--VP 153

  Fly   166 EKLTCDKWA-------FDKVENFLRNVDN-VREWRNYKPAVFFVYLADMDIAAHRFKPLSKKFFA 222
            ||    :||       .|.:.:....:.| :.:::.||..:|.:..|::..|.....|.|.:...
 Worm   154 EK----RWANLDDQHQTDNLRDIFPEIANRISKYQVYKQQMFLIRYANIGNAQKEHGPESDEVEQ 214

  Fly   223 KLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFM 277
            ::......|....:|.|.....|.|..::.||||.         :||:.|...||
 Worm   215 EVARFDLYINELQQLLEDRGLFSSTNLVVMSDHGY---------TPLQKEEQFFM 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 58/284 (20%)
PigN 414..839 CDD:282796
T03G6.3NP_508470.1 Enpp 22..413 CDD:293742 57/280 (20%)
Phosphodiest 24..366 CDD:279931 57/278 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.