DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side and side-V

Sequence 1:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_611765.2 Gene:side-V FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster

Alignment Length:1103 Identity:255/1104 (23%)
Similarity:397/1104 (36%) Gaps:345/1104 (31%)


  Fly    66 VGFTLVLLTCLQQLKS----VSADEESQDFQKNIPARLVWAALGKTVELPCDLTPPTS-QDSVKL 125
            |.|.|||.|.|..::.    .:|||.        |...:..|:|..|.|||||.|.|. .|.|:|
  Fly    14 VAFVLVLATALSLVQGEQHPATADEG--------PLSEILTAVGSEVALPCDLVPGTGIVDKVQL 70

  Fly   126 LLWFKDTTGIPLYSLDSRGGNVKLAPHAAIASDLGQRLFFSIGDNPKDSRLQINDVKPEDGGVYR 190
            ::|::.....|:|:.|:||..:.|....|..|...::..|....:|  ..|:|.:::..|.|:|:
  Fly    71 VIWYRQGNVKPIYTFDARGRPLNLGIPWADESVFNKKAHFHHDTDP--PALRIKNIQTSDAGLYK 133

  Fly   191 CRVDFFNSPTRNFRHNLTLVVPPEEPRIFDAQGKEI-SQMAGPFREGYELFLCCQVRGGRPPPKV 254
            |||||..|||||:|.|:|::|||....|.|..|.|| .|.|||:.||..:.|.|...||.|||:|
  Fly   134 CRVDFHKSPTRNWRINVTVLVPPTALTILDHHGAEIRDQTAGPYLEGDSIDLTCLSSGGVPPPRV 198

  Fly   255 TWWRDDTELIGTSHTSVEEGATVMVNQLLIGTTTRDFYGIRIECRAQGTRLVDPVRKDVTVQVYL 319
            :|||:.. ||..|...:.:|:  :.|.|.:....|........|:|....:|..:.|.|.:.:.|
  Fly   199 SWWREHA-LIDDSFQVLPDGS--VRNVLRLKNIQRKDLLTMYTCQASNGHVVPALTKKVILDMNL 260

  Fly   320 KPVRVKIATPNELLTAGQPMPIRCESWGSYPAAKITWLLDGEPIRNAEVTVHSDKEDGNITTSIL 384
            .|:.:.:...|..:.||....:.|.:.|:.|..:|.|...|:.:|.|   ..|...|||.|.|.|
  Fly   261 PPLSLLLQGLNHAVIAGTRSHVTCTAIGARPPPEIIWSKAGQIVRGA---TSSTSSDGNTTISEL 322

  Fly   385 TLKVTSENDNAELTCRAT---------------------NPWFSGGAIEDKRIIRVAYPPTVSVH 428
            .|....|::..::.|..:                     ....:|..::|.|::.|.:.|.|:::
  Fly   323 MLIPVPEDNERQVVCSISLNAGITSQQLHEGHTTVMTTLGNGHTGLYLKDSRVLNVTHAPIVNLN 387

  Fly   429 L-ANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRMSGE-----STEIMHLTQLERES 487
            | |..||..|:   :|.:|..:|...|.|.:|...|:.:..::...     |.:.:.|..:.:.|
  Fly   388 LGAPLDPDNLL---KGTDVYLECDVKANPAITRVEWYHSDKQLHSSRGIIISNQTLVLQGISKSS 449

  Fly   488 AGAYACGATNTEGETRSSSLTLKVQFSPRCKSGTEQTSIGAVSLHSILVKCEVDADPPDSVRFSW 552
            .|.|.|.|:|.:|...|:.:.|.|::.|.|||  |.|.|.|....:|.:.|||||:|.|::.:.|
  Fly   450 HGQYFCRASNLQGSVSSNEVYLDVKYPPVCKS--ESTIIRAALKQTINITCEVDANPVDNLNYKW 512

  Fly   553 TYNNT------------------------------------------------------------ 557
            .:||:                                                            
  Fly   513 HFNNSLESLIELPQLGQGAPVMLASGSDQSGYYQRSKRKHSHGMQQRLLHGRHGRMAAVRFEDED 577

  Fly   558 ----------------------------------------RNVSP-------------------- 562
                                                    :.:||                    
  Fly   578 EDGYGEFEEYGDEVGQPFTQMVYSNMVHKNHVESSKQQQRKQLSPQQQQQQQQMASGGSSGDSHT 642

  Fly   563 -------------VLNSRIQSNGLAS--TVTYLP----------QTDSELITLACWASNAVGRQT 602
                         .|:.:....|:|:  |.|..|          ::......::|.||:.:| .:
  Fly   643 PSGGVILERKRLVALHKQHHRGGVATPPTTTAAPPLNNVYSYHVESYESFGAISCVASSPMG-HS 706

  Fly   603 TPCLVHILPANTPEAPKACELRNDTV--LEVVCVAGSDGGLSQYFMLEVVGGDPLYSGDPGGSAG 665
            .||..||.||:.||..|.|...|.|.  |::.|:.|.|||:.|:|..::.               
  Fly   707 APCWYHIQPADLPEPVKNCTAYNATANSLQIQCIPGYDGGIPQHFHAQIY--------------- 756

  Fly   666 QGRGQFSEAIGLGDNEISTLNDQATSAPIFRMQENSPQFRLNNLEPGREYQFLVYAVNAKGRSEP 730
                                 |:.....::.......:|.:..|.....:...:.||||:|.|  
  Fly   757 ---------------------DELNRQILYNASYKYSEFTVKRLPSDSVFVIRITAVNAQGAS-- 798

  Fly   731 PVVIENVRVAAQLGPYDESILSEDPTPAETTHHGGGGVGGSGSSSGLGTGASTGSGPEKQSTLLI 795
                   :||.:|.                        |.:.|:..|.|.:||  ....|.|.|:
  Fly   799 -------KVAYRLR------------------------GRTLSAPLLRTASST--AVLVQLTPLL 830

  Fly   796 LAAVVVIGAVVVTSIIVAGIVVVCRHRPRPPEPQEVRKSMRPARNDVPSMYIEEDELNELEEGG- 859
            .|.|.||..:::.:|.|   |:|.:.|.:                                .|| 
  Fly   831 GALVGVIATLILVAICV---VIVIKFRSK--------------------------------RGGR 860

  Fly   860 --GRAADIRARVAPPNSHLCGGGGMPMPGGVGSSGGAIVGVAGPHHYISESFIQYAQPSLNGDVL 922
              |..||.....|..      |...|:...:||           |..:.:.         |.|| 
  Fly   861 RHGSGADATTTEADK------GSAEPLSRNMGS-----------HSSLEDK---------NPDV- 898

  Fly   923 LPLLVTSSQPCSTNSTISSVVLAMPQAKLCPDPASRNTAWPPEYPDLILPR-----GELEFTT 980
            :|....|.............:....|..|...|...|||.||  |..:.|.     |||..||
  Fly   899 VPQEANSEDEFHQEEKAFDRLNMESQRILYTPPTRINTASPP--PPSLSPTFGKQYGELSLTT 959

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:284989 43/117 (37%)
IG_like 100..211 CDD:214653 42/112 (38%)
Ig 235..301 CDD:299845 22/66 (33%)
Ig 326..408 CDD:299845 21/103 (20%)
IG_like 329..407 CDD:214653 21/99 (21%)
IG_like 435..511 CDD:214653 19/81 (23%)
Ig_2 442..511 CDD:290606 18/74 (24%)
FN3 <700..735 CDD:238020 8/35 (23%)
side-VNP_611765.2 Ig 42..153 CDD:299845 42/113 (37%)
IG_like 42..152 CDD:214653 42/112 (38%)
IGc2 179..245 CDD:197706 22/69 (32%)
IG_like 179..245 CDD:214653 22/69 (32%)
Ig <282..348 CDD:299845 18/69 (26%)
IGc2 400..459 CDD:197706 14/59 (24%)
FN3 719..798 CDD:214495 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793709
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.