DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side and ed

Sequence 1:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001260013.1 Gene:ed FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster

Alignment Length:755 Identity:165/756 (22%)
Similarity:278/756 (37%) Gaps:161/756 (21%)


  Fly   295 RIECR--AQGTRLVDPVRKDVTVQVYLKPVRVKIATPNEL--LTAGQPMPIRCESWGSYPAAKIT 355
            |.|||  |:||..  .|.::......|.|....:.:|..:  .|..:||.:.|.|.|..|...||
  Fly   123 RFECRIKAKGTGA--DVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSSIGGSPDPTIT 185

  Fly   356 WLLDGE--PIRNAEVTVHSDKEDGNITTSILTLKVTSENDNAELTC----RATNPWFSGGAIEDK 414
            |..:|.  |:....:...:..:..|.|.||:..:   |:|.|:..|    ||.|   .|..:|..
  Fly   186 WYREGSNTPLPATVLKGGTKDQPTNATLSIIPRR---EDDGAKYKCVVRNRAMN---EGKRLEAT 244

  Fly   415 RIIRVAYPPTVSVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRMSGESTEIMH 479
            ..:.|.|.|.|.|  ..|:|.|:   ...:....:|..||:|.|.:..|.:||..:|......:|
  Fly   245 ATLNVNYYPRVEV--GPENPLRV---ERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIH 304

  Fly   480 LTQLERESAGAYACGATNTEGETRSSSLTLKVQFSPR--CKSGTEQTSIGAVSLHSILVKCEVDA 542
              ::..:.||.|.|.|.|..|:|....|.|.:.:.|.  .:|.|.:...|    .::.::|.|.|
  Fly   305 --RVSVQDAGKYTCIADNGLGKTGEQELILDILYPPMVVIESKTREAEEG----DTVTIRCNVTA 363

  Fly   543 DPPDSVRFSWTYNNTRNVSPVLNSRIQSNGLASTVT---------YLPQTDSELITLACWASNAV 598
            :|. .|...|...|:.:        .:.||...|:|         |:.:..:.:.:.....|..|
  Fly   364 NPA-PVTIEWLKENSPD--------FRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV 419

  Fly   599 GRQTTPCLVHILPAN---TPEAPKACELRNDTVLEVVCVAGSDG-GLSQYFMLEVVGGD------ 653
            |..|...||...|..   ||..| ...:.|...|  .|.|...| .:.||.....:.|:      
  Fly   420 GNSTVALLVRHRPGQAYITPNKP-VVHVGNGVTL--TCSANPPGWPVPQYRWFRDMDGEFSSTQK 481

  Fly   654 -----PLYSGDPGGSAGQGRGQFSEAIGLGDNEISTLNDQATSAPIF--RMQENSPQFRLNNLEP 711
                 |.||........:|:........||...::|:..:....|.|  ::|::..: |:.:.: 
  Fly   482 ILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQFLAKLQQHMTR-RVADTD- 544

  Fly   712 GREYQFLVYAVNAKGRSEPPVVIENVRVAAQLGPYDESILSEDPTP-----------AETTHHGG 765
                    |.|....:.:|...::.::.|.::.| :|::......|           ::....|.
  Fly   545 --------YTVTCSAKGKPAPSVKWLKDAVEILP-EENLYEVQTNPDQGLNGMVTVQSQLKFRGK 600

  Fly   766 GGVGGSG---SSSGLGTGASTGSGPEKQSTLLIL---AAVVVIGAVVVTSIIVAGIVVVCRHR-- 822
            ....|:.   ...||.|...........|::.:.   ..:|:.....|...|.....|||:.:  
  Fly   601 ARPNGNALVPGDRGLYTCLYQNEVNSANSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAY 665

  Fly   823 PRP---------PEPQEVRK------SMRPARNDVPSMYIEEDELNELEEG--GGRAAD----IR 866
            |:|         |.|..:..      |.....||:.:..::.:.|...:.|  ..|.|:    ||
  Fly   666 PKPEFQWQFGNNPSPLTMSSDGHYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIR 730

  Fly   867 ARV-----APPNSHLCGGGGMPMPGGVGSSGGAIVGVAGPHHYISESFIQYAQPSLNGDVLLPLL 926
            |.:     .||..          |..:.::.   ||    |:|:|.|:    .|..:|.:     
  Fly   731 APIRLQQKGPPEK----------PTNLRATE---VG----HNYVSLSW----DPGFDGGL----- 769

  Fly   927 VTSSQPCSTNSTISSVVLAMP-QAKLCPD---PASRNTAW 962
                  ..|...:|...:||| :.:|.||   .|:.|:||
  Fly   770 ------SKTKFFVSYRRVAMPREEQLIPDCATLANSNSAW 803

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:284989
IG_like 100..211 CDD:214653
Ig 235..301 CDD:299845 5/8 (63%)
Ig 326..408 CDD:299845 24/90 (27%)
IG_like 329..407 CDD:214653 24/86 (28%)
IG_like 435..511 CDD:214653 21/76 (28%)
Ig_2 442..511 CDD:290606 20/69 (29%)
FN3 <700..735 CDD:238020 4/35 (11%)
edNP_001260013.1 Ig 50..147 CDD:299845 8/26 (31%)
I-set 146..249 CDD:254352 28/109 (26%)
Ig 168..249 CDD:299845 24/87 (28%)
IGc2 268..323 CDD:197706 16/57 (28%)
Ig_3 341..406 CDD:290638 15/78 (19%)
Ig_2 437..514 CDD:290606 17/80 (21%)
I-set 526..633 CDD:254352 17/118 (14%)
Ig 546..632 CDD:143165 12/87 (14%)
IG_like 654..736 CDD:214653 17/82 (21%)
Ig 656..734 CDD:143165 17/78 (22%)
FN3 741..848 CDD:238020 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.