DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side and CG31773

Sequence 1:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster

Alignment Length:93 Identity:20/94 (21%)
Similarity:33/94 (35%) Gaps:31/94 (33%)


  Fly   823 PRPPEPQEVRKSMRPARNDVPSMYIEEDELNELEEGGGRAADIRARVAPPN---SHLCGGGGMPM 884
            |.||.|...:.|::|...|                   :.|...|:|:|.:   :.|...||.| 
  Fly    92 PAPPTPISPKPSVQPKIPD-------------------QRAKWMAKVSPESQRKAKLAAAGGSP- 136

  Fly   885 PGG--------VGSSGGAIVGVAGPHHY 904
            |.|        ..:...|:.|.:.|.::
  Fly   137 PSGPPKNQFSQANNPSFAMPGQSSPANF 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:284989
IG_like 100..211 CDD:214653
Ig 235..301 CDD:299845
Ig 326..408 CDD:299845
IG_like 329..407 CDD:214653
IG_like 435..511 CDD:214653
Ig_2 442..511 CDD:290606
FN3 <700..735 CDD:238020
CG31773NP_722953.1 folC 309..745 CDD:273659
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.