DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side and syg-2

Sequence 1:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001309674.1 Gene:syg-2 WormBaseID:WBGene00007750 Length:1230 Species:Caenorhabditis elegans

Alignment Length:808 Identity:171/809 (21%)
Similarity:296/809 (37%) Gaps:216/809 (27%)


  Fly   146 NVKLAPHAAIASDLGQRLFFSIGDN-PKDSRLQINDVKPE-------DGGVYRCRVDFFNSPTRN 202
            |:.:.|.....|:.......::.:| |.:....:.:||||       ||.|....|...::|..|
 Worm   121 NIIVPPQLVYFSNYQPNSIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVKQASTPHLN 185

  Fly   203 ----------------------------------FRHNLTLVV--PPEEPRIFDAQGKEISQMAG 231
                                              ...|.||.|  ||.:|.:      ||.:...
 Worm   186 KTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTV------EILRNPS 244

  Fly   232 PFREGYELFLCCQVRGGRPPPKVTWWRDDTELIGTSHTSVEEGATVMVNQLLIGTTTRDFYGIRI 296
            ..|.|..:.:.|.|.||.|||.|.|:.::..|  .||::::..:..:.|......:..|... ..
 Worm   245 ALRSGDNVTIACSVTGGNPPPDVFWYHENKRL--QSHSTLDTRSKEIKNIYSFIASQNDNMA-EY 306

  Fly   297 ECRAQGTRLVDPVRKDVTVQVYLKPVRVKIATPNELLTAGQPMPIRCESWGSYPAAKITWLLDGE 361
            ||||..:|..:|.||.:.::|...|..|::...:. :..|....|:|:|..|.||::|||:::|.
 Worm   307 ECRANNSRTGNPKRKAMKLEVNYPPASVELFGESN-IRYGSSANIQCKSLPSNPASQITWIINGR 370

  Fly   362 P---------------IRNAEVTVHSDKEDGNITTSILTLKVTSENDNAELTCRATNPWFSGGAI 411
            .               :.::.|:|||::           |.|.:...|.|  |.||||   .|:.
 Worm   371 SVPTPTQREFVVENGIVSSSNVSVHSNE-----------LSVEAHQINVE--CMATNP---EGSS 419

  Fly   412 EDKRIIRVAYPPTVSVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRMSGESTE 476
            ..:.:|::..||...:....||....    ||..|...|.|....|:...||::...:...:..:
 Worm   420 AKQHVIKIIAPPKAPIITGLEDRKFF----EGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRK 480

  Fly   477 IMHLTQL---ERESAG--AYA----------------CGATNTE-GETRSSSLTLKVQFSPR--- 516
            .|..:|:   ..|.||  :|:                |.|||.. .|....|..|.|.:.||   
 Worm   481 KMKWSQVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEATNAALDEPLIESQYLSVYYPPRRVL 545

  Fly   517 ---CKSGTEQTSIGAVSLHSILVKCEVDADPPDSVRFSWTYNNTRNVSPV------LNSRIQSNG 572
               ..||.::..:|    .|..:.|...:..| :...||.::...:.:.|      ||...:.||
 Worm   546 IRPADSGDQRLLVG----KSARLVCGTLSSNP-AAHISWQFSRATDDNKVHLGDVSLNETTRDNG 605

  Fly   573 --LASTVTYLPQTDSELITLACWASNAVGRQTTPCLVHILPANTPEAPKACELRNDTVLEVVCVA 635
              :.:.:::.|..:.:...:.|.|::...:.:...   ..|.|....||.  |.||.|..|:   
 Worm   606 FNVENVLSFTPTEEYDGTVVHCIANHPEWKHSVNT---SFPLNVMYPPKM--LVNDPVTVVM--- 662

  Fly   636 GSDGGLSQYFMLEVVGGDPLYS-------GDPGGSAGQGRGQFSEAIGLGDNEISTLNDQ---AT 690
             |:|...:..:  .|.|:|..|       |.|          |...||......:.|:.:   :|
 Worm   663 -SEGDSFKENL--TVRGNPAISLWQWRKNGVP----------FDHTIGRVFARGAVLSGKQLLST 714

  Fly   691 SAPIFRMQENSPQFRLN-NLEPGREYQFLVYAVNAKGRSEPPVVIENVRVAAQLGPYDESILSE- 753
            .|.::.:...:.....| .::...||...:.:::.      ||:       |..|   :::|.| 
 Worm   715 DAGVYTLTATNSVGSTNITIKLAVEYSARITSIST------PVI-------AATG---DTVLLEC 763

  Fly   754 ----DPTPAETTH-----------HGG--------------GGVGGSGSSSGLGTGASTGSGPEK 789
                :|:.|...|           |.|              .|.....:.:|:|..|      |.
 Worm   764 EADGEPSKANMIHWYKNGEILAAQHRGHKKAILRLNATEQQSGEYTCKADNGIGVPA------EG 822

  Fly   790 QSTLLILAA--VVVIGAVVVTSIIVAGI 815
            |:.||:.:|  |:.:.....|:.|:.|:
 Worm   823 QTFLLVNSAPRVLPVARYAKTAGILGGV 850

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:284989 18/107 (17%)
IG_like 100..211 CDD:214653 18/107 (17%)
Ig 235..301 CDD:299845 19/66 (29%)
Ig 326..408 CDD:299845 24/97 (25%)
IG_like 329..407 CDD:214653 24/93 (26%)
IG_like 435..511 CDD:214653 21/98 (21%)
Ig_2 442..511 CDD:290606 21/91 (23%)
FN3 <700..735 CDD:238020 5/36 (14%)
syg-2NP_001309674.1 IG_like 25..105 CDD:214653
Ig 33..122 CDD:299845 1/1 (100%)
Ig 147..228 CDD:299845 14/81 (17%)
IGc2 248..313 CDD:197706 19/68 (28%)
Ig 450..537 CDD:299845 19/87 (22%)
Ig 559..632 CDD:299845 14/78 (18%)
I-set 657..738 CDD:254352 17/97 (18%)
Ig 665..738 CDD:299845 14/85 (16%)
IG_like 748..828 CDD:214653 19/102 (19%)
IGc2 756..817 CDD:197706 10/64 (16%)
Ig 845..922 CDD:299845 2/7 (29%)
FN3 934..1023 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.